KEGG   Cryptococcus gattii: CGB_D4340CHelp
Entry
CGB_D4340C        CDS       T02232                                 

Definition
regulatory associated protein of mTOR
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cgi  Cryptococcus gattii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(980186..980320,980424..980601,980651..980773,980823..981043,981095..981303,981353..981477,981532..981649,981706..981814,981863..984539,984598..984652,984707..984851,984913..984962,985012..985194,985265..985505))
Genome map
AA seq 1522 aa AA seqDB search
MTQYGETPSLPYARDESSTSQVQSAYPAYPAETYEHQEAFEDEEDDFSADVDVGAALQYW
TALRHMGGKGKQKEDSEEDKTSKSPWRLRSKLKTVTAGLFICLNLGVDPPDIVKTNPCAK
TECWIDPTQLPAPKAIDAIGRNLHQQFETLNPKVKYKAFLDPSIEDTKKNCISMRKTTKD
ERVVFYYNGHGVPRPTPSGEIWVFNKNYTQYIPVSLYDLQEWLGSPCIYIWECSAAGNIL
NNFMKSAERRDAEARHAAAQAGHEDLPRTSYTEALHLAACKANQILPMSPDLPADLFTCC
LTSPIETALRHFVLQDPLPRNTGLSPDDPRSRITVDLAMRIPGDLKDRRTPLGELSWIFT
AVTDTIAWLSFPRDMFNKLFRQDLLVAALFRNFLLAQRIMSAYHCTPTSIPEIPDTHNHP
LWESWDLAVDACLAQLPGIFDQLGEPEPGKPLTIPPGMYKPSTFFAQHLQAFEVWLQHGA
TVPNKRAARNRNEVVPRSPPEQLPIVLQVLLSQSHRLRALILISRFVDLGPWAVHLSLSI
GIFPYVQKLLASPAIELKPVLIYIWARILAIDQSCQIDLLRDSGFTYFTQILAAYPQQGS
LVIPNANEHRAMSAFILSILCRDFRQGQTACLNTHVFDACVARLHEDDWLLKTWCLLCVG
QLWADYDEAKALFWQSQRQGELLSALRSTSVEVRAAALYAFGTLLGASAISIETPAKGGG
GTGAQIGLSDVQQLELEAGVAFACMMSVKEDASPLVRKELVVVISCVVREWRGWLVCAAW
VYYEQEAALVAMEDDKPMPKDVVSDTLEQWTMNEDKHPEEHQHNLTLLSSFKVLFETLLD
LSVDPHTEVALTASTVVDYIIALLMDSPFVRVEGSAIRSLIKQHSRPRNPPRQASTGHFE
RHKLSHLNGVPPTLTRASSHHDKSAADSIPSLKRNSSVANALRSLASMTGFSAPETPSEE
PPSTEPRQEIPTAPDLSTSAYISPYPETGHERVQPDSHSTSTSGTGRKPSSLKYLNTHMN
TRSSLGILPPRLDQTPVEAYQILEALTREDMERLRMRRMRGRDAGGDVDGRYGNNGLPRS
TDLGLGMVAKEVKDDVLPLRSGYFDWAMDYFRTPQMKAPDADEPGSQTYNEQAWKHQRNE
QMVERSRASEEFAATHSWNLEAGTLHNDAWPLQLAFHSYDPVLAVTDDTDKICVWDWQNK
VKLNKFSNQNIGGSSISSIHFVNEMASSLMLTASTEGSIRIFRDYEIPGETALASTFRAV
SETYPVAHSSGLLTAWEQQKGHLLVGGDMKVVRLWDATVERHLRDIATQAGSNLTAISSD
EPDGNVFVAGFGDGVVRLFDKRAEDAGEVVLRTWRQHKIWIQSVHLQKGSMRELVTGSMD
GEVRVWDVRKPDEPLYTLPRRNEGLMALAVHTGAPVLARTTAITPYSTKQDLEITGFKNP
LQPQRLAKISIPVPPAYNTPRHRAVDFLPSSASLVFHPVEMVVAAGGFDTSGTVKLYRCP
APDLPLGGNWDQSNGVVNGYLY
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtacggagagactccatccctcccgtacgcccgcgacgaaagctcgacgtct
caagtccagtcggcctatccggcttatcccgccgaaacttacgaacatcaggaagcattt
gaggatgaggaggatgatttctcagccgatgtcgatgtcggggctgcactgcagtactgg
actgctttaaggcatatgggtggtaaaggaaagcaaaaagaggattcagaagaggacaaa
acgagcaaatcgccttggcgtctcaggtcaaagctaaaaaccgtgacagctggtctgttc
atttgcttgaatcttggagttgatccgcccgacatcgtcaagaccaatccatgtgctaag
acggaatgctggatcgacccgacgcagttgccggcacccaaggctatagatgccattggc
agaaatctgcatcaacaatttgagactttaaatcccaaggtcaaatacaaggcgttcctt
gatccgtctatcgaagacaccaagaagaattgcatcagcatgaggaaaaccaccaaggac
gaacgagtggtcttctactataacgggcatggggtccctcgtccaactccttcaggagaa
atctgggtgttcaataaaaactatacccaatacattcccgtaagcttgtatgacttgcaa
gaatggcttggatcgccatgtatctacatttgggaatgctcagcggccggtaacatcctc
aacaactttatgaagtctgctgaacgtcgtgacgcagaggctcgtcatgctgccgctcaa
gctggtcatgaagatctcccccgtacctcctacactgaagcactccatctcgcagcttgc
aaagccaatcagatcctacccatgtcacctgacctccctgctgatctctttacctgttgc
cttacgtctcctatcgaaactgctctccgtcattttgttcttcaggatcctttaccgaga
aacactggcttgagtcctgatgacccaaggtcaaggataacagtggaccttgcaatgagg
ataccgggtgacttgaaggataggaggacaccattgggagagctgagctggatatttacc
gctgtgacagatacgatcgcatggttgtcattccctagggacatgtttaacaaactcttc
cgacaagatcttctcgtggctgctctgttccgcaatttcctcctggctcaaagaattatg
tcggcttaccattgcacacctacatcaatcccagaaatcccggacacacataatcatccg
ctctgggaatcatgggatctagccgtcgacgcatgtctcgcgcagcttcctggaatattt
gatcaactgggtgaacctgagccaggaaagcctttgacaattcctcctggaatgtacaaa
ccatcgaccttcttcgcccaacatctacaagcatttgaggtctggctgcaacacggcgcc
acagttccaaacaaacgagcagctcggaatcgcaatgaagttgttcctcggtcaccacca
gagcaactccccattgttttgcaggttctgctttctcaatcccatcgtttacgagccctt
attcttatctcacgattcgtcgatctcggcccttgggccgttcatttgtcactttcgatc
ggtatctttccctacgtccagaaacttcttgcttctccggccattgagttaaaaccggtt
ttgatctacatttgggcacgaatcttggccatcgaccagtcatgtcaaatcgacctcttg
cgtgattctggcttcacctatttcactcaaatccttgctgcctaccctcaacaaggctct
ctggtcatccccaatgccaatgaacatcgtgccatgtcggctttcattctaagtatactc
tgtcgcgactttaggcaaggacagacggcgtgcctcaatactcacgtttttgatgcttgc
gttgcgcgattgcacgaggacgattggctgttgaagacctggtgtcttctttgcgttggc
cagctctgggctgattacgacgaggcaaaagcactgttttggcagtctcagcgacagggc
gagctcctctctgctctacgaagcacatctgtggaagtacgtgccgcggctctgtatgcc
tttggtactcttttaggcgcatcagccatctcgattgagactcctgcaaagggagggggc
ggaactggcgcccaaatcggtctttctgacgttcaacagttagagttggaggccggtgtc
gcattcgcgtgtatgatgtctgtcaaagaggatgctagccctttggtccgtaaagagctg
gttgtcgtaatcagctgcgtagtgcgagaatggaggggttggctggtctgcgccgcttgg
gtgtactacgagcaggaggcggccttagttgccatggaagacgacaagcccatgcccaag
gatgtggtatcagatacgcttgaacaatggacaatgaacgaggacaagcatcctgaagag
catcagcacaacttaacgctgcttagcagcttcaaggtgctttttgagacactattggac
ttgtctgtggaccctcatacagaggttgccttaacagcgtctactgtggttgattatatc
atcgcccttcttatggactcacctttcgtccgagtggaaggctcggccattcgcagcctc
atcaagcaacatagccgaccacgaaatccccctcgtcaggcttctactggtcattttgaa
agacacaagttatcccatcttaatggtgtaccgcccactctcaccagagccagttcacac
catgacaaatctgcggctgatagcattccatccctaaaacgaaacagttctgtggccaac
gctctaaggagtcttgcatccatgaccggcttcagtgctcctgaaactccttctgaagag
ccaccgtccactgaaccccgacaagaaattcctactgctcctgatctttccacttcggcc
tacatttcaccttaccctgaaaccgggcatgagcgtgtccagcctgactctcattctact
agcacttctggcaccggccgcaaaccttcttcgctgaaatacctcaacactcacatgaac
acccgctcttcgcttggaatccttcctcctcgactcgatcaaacgcctgttgaagcatac
cagattctcgaggcgcttacgagagaggatatggagcgtttgagaatgaggaggatgaga
ggcagagatgctggtggagacgtggatggacgttacggaaataacggtttgccgagatcg
acagatttaggactggggatggttgctaaggaagtcaaggatgatgtattaccgctaagg
agcggatactttgactgggcaatggactactttagaacaccccagatgaaggcgccagat
gcggatgagccgggtagtcagacttataatgaacaggcatggaaacatcagagaaatgag
cagatggtcgagaggagtcgggcaagtgaagagtttgctgccactcactcatggaatttg
gaagccgggacattgcataatgacgcgtggcctcttcaactggcgttccattcttatgac
cctgttttagcggtcactgacgacactgacaagatctgcgtttgggactggcaaaataaa
gtcaaactcaataagttcagcaatcaaaatatcgggggaagcagtatctcgtcaatacat
ttcgttaacgagatggcatcatctttaatgctaacagcgtcgacggaaggaagcattcgt
atcttccgtgactacgagatacctggcgaaacggcactcgcatcaaccttccgcgccgtc
tccgagacctatcctgtcgctcatagcagcggtctgcttacggcctgggaacagcaaaag
gggcatctactcgttggaggtgacatgaaggtcgtaagattatgggatgctactgtggag
aggcatcttcgagatattgctacgcaagctggatctaatcttactgccatctcttctgac
gagccagacggcaacgtgttcgttgcaggctttggtgatggtgtcgttagactgtttgat
aagcgtgcagaagatgctggcgaagtggtattgaggacttggagacagcataaaatctgg
attcagagtgtgcatttgcaaaaaggaagcatgagagaattggtcactggaagcatggac
ggtgaagtcagagtctgggatgtgaggaagccagacgagccgctatatacattaccgcgc
agaaatgaaggcttaatggctttggctgtgcacactggtgctcctgtgcttgcgcggacc
acggcaatcacaccatattcaaccaaacaagacctcgaaatcaccggcttcaagaatcca
ctgcagccccaaagactggctaagattagtattcctgtgccacccgcgtataacacgccc
aggcatcgagctgtagattttttgccaagctcagcttccttggtattccatcctgttgaa
atggtggtggcggccggcggattcgacacgtctggcacggtcaagctgtacagatgccca
gcaccggatcttcctcttgggggcaactgggaccagtcgaatggcgtagtgaatgggtat
ctttattag

DBGET integrated database retrieval system