KEGG   Cryptococcus gattii: CGB_D4870WHelp
Entry
CGB_D4870W        CDS       T02232                                 

Definition
dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cgi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cgi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cgi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(1115566..1115638,1115696..1115901,1115950..1116333,1116382..1116565,1116615..1116689,1116739..1117247)
Genome map
AA seq 476 aa AA seqDB search
MLSFAQVAKRSAAVGFRRQAVASRTLRTSAPSNALSKFAMPAMSPTMTEGGIAQWKKKEG
ESFSAGDVLIEIETDKATIDVEAQDDGVMAKIIAQDGAKNIAVGTPIAILAEEGDDLSQA
DALAAESQSESASQKEAAPKEEKPVSKEKSEPSTTPAVGTPGEQKFGSGDAQTSPAKAPE
HPSKGDRPKFFASPLARKIALENGVPLAEIKGTGPNGRIIEADVKNYKPSAAASTSAVGK
PAAVPADYEDIPTSNMRRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKAGEGKT
KLSVNDFIVKAASLALADVPEANSAWLGETIRMYKKADICVAVATPTGLITPIIKDVGAK
GLATISAETKALASRARDGKLKPEEYQGGTFTISNLGMFGVDQFTAIINLPQSCILAVGK
TSTKLELAPEDPKGFKAVQVMKVTLSADHRTVDGAIGARWLKAFREYMEQPLTFML
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcctttgcacaggtggccaaacgctccgcagcggtcggttttaggaggcaggct
gtggcctcaaggactcttcgtacttctgcgccatctaacgccctcagcaagttcgccatg
cctgccatgtctcctactatgactgaaggcggtattgctcagtggaagaagaaggaagga
gaaagtttctctgctggtgatgtacttattgaaattgagacggacaaggccaccatcgat
gttgaggctcaggacgatggtgttatggccaagattattgctcaagatggtgctaagaac
atcgccgttggcactcctattgccattcttgctgaggagggtgatgacctctctcaagcc
gacgccctcgccgccgagtcccagtctgagtctgcctctcagaaggaggcggcacccaag
gaggagaagcccgtttccaaggagaagtctgagccttcaacaactcctgctgttggtacc
cctggtgaacagaagtttggctctggtgacgcccaaacatcccctgccaaggcccccgag
caccctagtaagggcgacaggcccaagttcttcgctagccctcttgctaggaagatcgca
ttggagaatggtgtccccttggctgagatcaagggtactggacccaatggcaggatcatt
gaggccgatgtcaagaactacaagccttctgccgccgcttccacttccgccgtgggcaag
cccgctgctgtgcctgccgattacgaggatatcccaacctccaacatgcgcagaaccatt
ggcaagcgattgactgaaagcaagcaacaattgcctcactactatgtgactgtggaggtc
aacatggaccgagtattgaagcttagggaagtattcaacaaggctggtgaaggcaagact
aagctgtctgtcaatgacttcatcgtcaaggctgcttctttggctctcgctgacgtcccc
gaggccaactctgcttggcttggcgagaccatccgcatgtacaagaaagccgacatctgt
gtcgctgttgctacccctaccggtctcattacccccatcatcaaagacgtcggtgccaag
ggtcttgcaactatttctgccgagaccaaggctcttgcctcccgtgctcgtgacggaaag
cttaagccggaagagtaccaaggcggcactttcaccatttccaaccttggcatgttcggc
gtcgaccaatttactgctatcattaacctccctcaatcttgtatcctcgctgttggcaag
acctcgactaaactcgagcttgctcctgaggaccccaagggcttcaaggctgttcaggtt
atgaaggtgactttgagcgctgaccacaggactgtggatggcgcgattggagcgaggtgg
ttgaaggctttcagggaatacatggaacaaccccttacttttatgctttag

DBGET integrated database retrieval system