KEGG   Cryptococcus gattii: CGB_D4870WHelp
Entry
CGB_D4870W        CDS       T02232                                 

Definition
dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGB_D4870W
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_D4870W
   00020 Citrate cycle (TCA cycle)
    CGB_D4870W
   00620 Pyruvate metabolism
    CGB_D4870W
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CGB_D4870W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(1115566..1115638,1115696..1115901,1115950..1116333,1116382..1116565,1116615..1116689,1116739..1117247)
Genome map
AA seq 476 aa AA seqDB search
MLSFAQVAKRSAAVGFRRQAVASRTLRTSAPSNALSKFAMPAMSPTMTEGGIAQWKKKEG
ESFSAGDVLIEIETDKATIDVEAQDDGVMAKIIAQDGAKNIAVGTPIAILAEEGDDLSQA
DALAAESQSESASQKEAAPKEEKPVSKEKSEPSTTPAVGTPGEQKFGSGDAQTSPAKAPE
HPSKGDRPKFFASPLARKIALENGVPLAEIKGTGPNGRIIEADVKNYKPSAAASTSAVGK
PAAVPADYEDIPTSNMRRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKAGEGKT
KLSVNDFIVKAASLALADVPEANSAWLGETIRMYKKADICVAVATPTGLITPIIKDVGAK
GLATISAETKALASRARDGKLKPEEYQGGTFTISNLGMFGVDQFTAIINLPQSCILAVGK
TSTKLELAPEDPKGFKAVQVMKVTLSADHRTVDGAIGARWLKAFREYMEQPLTFML
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcctttgcacaggtggccaaacgctccgcagcggtcggttttaggaggcaggct
gtggcctcaaggactcttcgtacttctgcgccatctaacgccctcagcaagttcgccatg
cctgccatgtctcctactatgactgaaggcggtattgctcagtggaagaagaaggaagga
gaaagtttctctgctggtgatgtacttattgaaattgagacggacaaggccaccatcgat
gttgaggctcaggacgatggtgttatggccaagattattgctcaagatggtgctaagaac
atcgccgttggcactcctattgccattcttgctgaggagggtgatgacctctctcaagcc
gacgccctcgccgccgagtcccagtctgagtctgcctctcagaaggaggcggcacccaag
gaggagaagcccgtttccaaggagaagtctgagccttcaacaactcctgctgttggtacc
cctggtgaacagaagtttggctctggtgacgcccaaacatcccctgccaaggcccccgag
caccctagtaagggcgacaggcccaagttcttcgctagccctcttgctaggaagatcgca
ttggagaatggtgtccccttggctgagatcaagggtactggacccaatggcaggatcatt
gaggccgatgtcaagaactacaagccttctgccgccgcttccacttccgccgtgggcaag
cccgctgctgtgcctgccgattacgaggatatcccaacctccaacatgcgcagaaccatt
ggcaagcgattgactgaaagcaagcaacaattgcctcactactatgtgactgtggaggtc
aacatggaccgagtattgaagcttagggaagtattcaacaaggctggtgaaggcaagact
aagctgtctgtcaatgacttcatcgtcaaggctgcttctttggctctcgctgacgtcccc
gaggccaactctgcttggcttggcgagaccatccgcatgtacaagaaagccgacatctgt
gtcgctgttgctacccctaccggtctcattacccccatcatcaaagacgtcggtgccaag
ggtcttgcaactatttctgccgagaccaaggctcttgcctcccgtgctcgtgacggaaag
cttaagccggaagagtaccaaggcggcactttcaccatttccaaccttggcatgttcggc
gtcgaccaatttactgctatcattaacctccctcaatcttgtatcctcgctgttggcaag
acctcgactaaactcgagcttgctcctgaggaccccaagggcttcaaggctgttcaggtt
atgaaggtgactttgagcgctgaccacaggactgtggatggcgcgattggagcgaggtgg
ttgaaggctttcagggaatacatggaacaaccccttacttttatgctttag

DBGET integrated database retrieval system