KEGG   Cryptococcus gattii: CGB_D5180CHelp
Entry
CGB_D5180C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CGB_D5180C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1165310..1165400,1165455..1165538,1165607..1165660,1165718..1165817,1165867..1165928,1165983..1166212,1166262..1166401,1166465..1166717,1166767..1166886))
Genome map
AA seq 377 aa AA seqDB search
MSFRAPNLLRSTVGRRAGQALNLRSQVIRRRFATEGGPELGKPSPQRSSNTGYLLAGFGI
AAAGAAYYFYSSGATARDSTGKADTAVRGAVATVEAKTGLRRGKDDYQKVYNRIAETLEK
EGYDDGSLAPVLIRLAWHSSGTYNKEDGSGGSNYATMRFKPESDHSANNGLNVAREHMEK
IKKEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRIDGYAAQVTPDGRLPDATQAQDHL
RFIFNRMGFNDQEIVALSGAHAMGRCHTTRSGFDGPWTFSPVTFSNQYFALLRDEPWQWR
KWNGPAQYEDKKTKTLMMLPTDMALVKDKSFKKYVDIYANDEEKFFNDFSKAFSKLIELG
VPERQWAGEPWTMTTSE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcagagctcccaacttgttgcgatccaccgttggccgacgagccggtcaggcg
ttgaacctgcgttctcaggttatccgaaggcgatttgcaactgagggtggaccagaactt
ggtaaaccatctcctcaacgatcctctaacaccggttatctcctcgcaggtttcggtatt
gctgctgcaggtgctgcatactacttctacagctctggcgcaaccgcgcgtgattccacc
ggtaaagcggacactgcagtacgtggggctgttgccacggttgaggccaagacaggtctc
agaagaggcaaggatgactatcagaaagtctacaaccggattgccgaaactcttgagaag
gagggttacgacgatggctctttggcccccgtccttattcgcttggcttggcactcctcc
ggaacctataacaaagaggatggaagtggaggctcgaactatgctaccatgaggttcaag
ccagagtccgaccacagcgcgaacaatggccttaacgttgccagggaacatatggaaaag
atcaagaaggagttcccctggatctcctacggggacttgtggactctcggtggtgtctgt
gccgttcaggagtcgggcggacctaccatcccttggaggcctggtagaattgacggttac
gccgctcaagtcactcccgatggtaggctgcctgatgccactcaggctcaagaccatctg
aggtttatcttcaaccgcatgggatttaatgaccaagaaattgtagccctcagcggcgct
cacgccatgggaagatgtcatactactcgatctggctttgacggtccttggactttctcc
cctgtcaccttttccaaccaatactttgctcttcttcgcgacgagccttggcagtggagg
aaatggaacggacctgcccagtacgaggacaagaagacaaagactttgatgatgcttcct
acggatatggcgctcgtcaaggacaagtccttcaagaaatacgttgacatctatgcaaac
gacgaagagaagttctttaacgacttctctaaagcattctccaaactcattgagcttggt
gtccctgagaggcagtgggccggtgaaccttggactatgacaaccagcgaataa

DBGET integrated database retrieval system