KEGG   Cryptococcus gattii: CGB_D5350CHelp
Entry
CGB_D5350C        CDS       T02232                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cgi  Cryptococcus gattii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CGB_D5350C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CGB_D5350C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGB_D5350C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1206797..1207433,1207486..1207934,1207998..1208130,1208182..1208560,1208619..1208818,1208887..1209371))
Genome map
AA seq 760 aa AA seqDB search
MSRPIDLSMSSVKNPSPLAPGGTGGFTPVFEASPANSPAGSRRPSISQPSARRPSEVSIS
RRPSVNHQYNSYVSQYPQQGGQSLSRRSSMASGPRPIRRGEYSGPATPSVLSRAGSPTLP
LGNEFTQAPRSYFEGASSYTPLGGTRELRNGQFIGSLDCGTTSTRFIIFDKRAKIIAEHQ
TEFEQILPHAGWHEHDPDALVEAMNECITKAVEKLEWMGWSRNSVKGIGITNQRETTVCW
SRSTGKPLCNAIVWDDARTINVVREMEKKLDEEGLEIDDDEADEINQKSEIVPDEVEMGT
GTQEAAFGEKGNVVDGDASITGKIGKAMEGLGLSGRGKDGKAKKRRKGKEGLVDVTGIPL
STYFSAIKLRWMLDHQKAVRIAHEADDLMFGTVDTWLVYNLTGARNGGLHIMDVTNASRT
LLISLKTLQWHPPLLRFFGLRPSILPKIVSSAEVYGSISDSLGLPLSGVPIAGIVGDQQA
AMVGNKCLKKGQAKCTYGTGAFVLFNTGEDIVRSNYGLISTVAFQAGPNSKPIYALEGSI
AVAGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYFVTAFSGLLAPYWDREAAGTIIG
LTGYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRLDTLKVDGGVTNSDLAMQLQANIG
GFNVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAGVHTFEPELEEKVRLK
KIKGWNKAVDRAKKWHDIEDEDEEEEYEDEIGYTRIAESA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccccatagacctttctatgtcctcggttaagaacccctcgcctcttgcgcca
gggggtaccgggggctttactcctgtcttcgaggcttctcctgccaattctcccgctggt
tcccgtcgaccttctatctcccagccttcagctcgtcgtccttcagaagtctcaatttct
cgtaggccttccgtgaatcatcaatacaacagctacgtctcgcaatatcctcaacaaggc
ggccagtcgctttcccgacgatcatctatggcttccggcccgcggcctatccgacggggc
gaatactccggacctgccaccccttctgtcctatcacgagctggttcgcccaccttgcct
ctcggcaacgagtttactcaagctccaaggtcatattttgagggtgcttcaagctatact
cctttgggcggaacgcgagaattgcgcaatggacaattcattggtagtctcgattgtggt
actacctctacgcgatttatcattttcgataagcgcgcaaagattattgcagagcatcag
acggaattcgaacagattctccctcatgcaggttggcacgagcatgaccctgacgcgctg
gttgaagcgatgaacgaatgtatcaccaaagctgttgaaaagcttgaatggatgggctgg
tccagaaacagcgttaaaggcattggtatcaccaatcaacgagagactactgtatgctgg
tcacgttctactggcaagcctttgtgtaatgccattgtttgggatgatgcgcggaccatt
aatgtggttcgtgagatggagaagaagcttgacgaggagggcctagaaatagatgacgac
gaggcggacgagatcaatcaaaaatctgaaattgtgccagacgaagttgaaatggggact
ggtacgcaagaggcagccttcggggagaaaggtaatgttgtagatggcgatgccagtata
accggcaaaattggaaaagcgatggaggggctcggtctgtcgggcagaggtaaagatggt
aaggcgaaaaagcgcagaaagggcaaagaaggtctggtagacgttactggtattcctctc
tctacctacttttctgccatcaaacttcgatggatgttggatcatcagaaggccgtccga
atcgcccacgaagctgatgatctcatgttcggcaccgtcgatacttggcttgtctataat
ttgactggtgccaggaatggcggtctccatattatggatgttaccaatgcctctcgaaca
ctccttatctctcttaaaacacttcagtggcaccctcctctccttcgcttctttggcctt
cgaccttcgatccttcccaagatcgtatcttcggctgaggtgtacggcagtatttctgat
tcacttgggttaccactctccggtgttccaattgctggtattgttggtgatcagcaggcg
gcgatggtcggcaacaaatgtttgaagaagggccaggccaagtgcacttatggtactggt
gctttcgtcttattcaacactggcgaagacattgtcaggagtaactacggtctaatttct
accgtagcctttcaagcaggtccgaacagtaagcctatttatgcattggaaggttctatt
gctgtggctggatcggccatcaaatggcttcgagaccaaatgaccctcattgaagaatct
gccgagatggacatccttgctggatcagtgtcagacactggaggtgtctattttgttacc
gccttctctggtcttcttgcgccgtactgggatcgtgaagctgctggtactatcatcggt
cttacgggatacacaacttctgcccacattgctcgggccacccttgaggccgtgtgtttc
caaactcgcgcagttttagatgtcattgagaaggagagtggtagcaggcttgacacactc
aaggttgatggtggtgtgaccaactcagatttggctatgcagttgcaggctaatatcggt
ggcttcaacgttgcacgaccttcgatgcgcgagtctaccgctcttggttccgccttgcta
gccgcccatgcccttggcttgtttggttgggatttgacccgtccagaaactctcagtgag
gtgaacaccgctggtgtccacaccttcgagcccgagttggaggagaaagtcagactgaag
aagattaagggatggaataaggcagttgacagggccaagaaatggcatgacattgaggat
gaggacgaagaagaagaatacgaagacgaaatcggatacacaaggatcgccgagtcggct
taa

DBGET integrated database retrieval system