KEGG   Cryptococcus gattii: CGB_D5450CHelp
Entry
CGB_D5450C        CDS       T02232                                 

Definition
D-erythro-sphingosine kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cgi  Cryptococcus gattii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CGB_D5450C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CGB_D5450C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1235553..1235677,1235737..1235793,1235849..1236027,1236086..1236722,1236788..1236871,1236927..1237039,1237103..1237160,1237214..1237342,1237398..1237613,1237675..1237783))
Genome map
AA seq 568 aa AA seqDB search
MRPPNQLPVILNNNNLGLLAIQRSTLDVLQLSSDGRPPKRLVTCPLRNVLKAYLAPAPEN
SARRLDLHFLGGGKGTQLKLVKLHVLVEPIDIPETNEWTRCLMEAAYGSIEPFRNVLILV
NPVGGKGKAKNIVQDTVIPMLEAAGATVTVQETTHRLHAEEIARSMDLVYDVIATASGDG
LVYEVVNGLAARSDARKALLTPIAPIPTGSANAVCTNLFGVKDTFNIHLATLNIIKGCRL
PIDLCSILILPSMTRRFAFLSQAIGLMVDLDIGTENLRWMGDTRFLVGFLKGIANNKGAF
CRLRLKVVEDDKQDMARKAKERIRQRTIDGSGVVPLTNQMKSMSVDGDTPVSTNDDIPAA
GHGPPAMIQEPTPSASLPIPKSANANYVPDHGPIPDAQPLKYDGTWITIESLPKKPSTKL
KNSTQSLKAPPKASTQNKWVDGQGILYFYAGMMPWVARDLMQWPVSIPGDGLIDVVVQSV
VPRLTMANAIAGAEKGEAYWMDCQYYYKVSQFIAENLDIENQPLFTIDGEAFPFESFHVE
VHTRVANLLSLNGDFFTSDFLKKPTGKN
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccccaaatcagcttccagtcatcctcaacaataacaaccttggcctacttgcc
atccaacgatccactctagatgtccttcagctctcgagcgacggccggcctcccaagcga
ctagtcacatgccccttgagaaacgtcctcaaggcatatcttgctcctgctcccgagaat
tcagcgcggcggctggatctgcattttctaggtgggggcaagggcacgcagctgaaactc
gtcaaacttcatgtgttggttgagcccatcgatataccagaaacaaatgagtggacaaga
tgtctaatggaggcagcttatggttcaattgagcccttcagaaatgttttgatcttggtc
aaccctgtaggaggaaagggtaaagcaaagaatatagtgcaagatactgttattcctatg
cttgaagcagctggagcaactgtaaccgtacaagaaactactcataggctacatgccgaa
gagatcgcaagatctatggatctggtatacgatgtgattgccactgcttccggagacggt
cttgtctatgaggtcgtcaacggccttgcagcccgctctgatgcccgcaaggctttgttg
acgcctatcgcccccatcccgacaggttcggccaatgctgtttgcaccaacttattcggc
gtgaaggacactttcaacatacatttggctacgctcaacattatcaaaggatgtagactc
cccattgatctttgctccatccttattctcccatccatgactcgacggttcgcttttctt
tctcaagcaattggtctcatggtagatctcgacattgggacagaaaatctcagatggatg
ggggataccagatttttagttggctttcttaaaggaatagcgaacaataagggagcgttt
tgtcgattgagactcaaagtcgttgaagacgacaagcaagacatggctagaaaggcaaag
gaacggatacggcaaaggacgattgacggtagcggtgttgttccgttgactaaccagatg
aaaagcatgagcgtagacggtgacacgccggtttctacaaatgatgacattccagctgct
gggcatgggcccccagcaatgatccaagaacctacgccatccgccagcctcccgatacca
aagtccgcaaacgccaattatgtcccggaccatggtcccattccagatgctcagccgcta
aaatacgatgggacttggataactattgaaagtctccctaaaaagccatccaccaagctt
aaaaactctactcagagtttgaaagccccaccaaaggcttcaacacaaaacaaatgggtt
gacgggcaagggattctatatttctatgccgggatgatgccatgggtagctcgagatctg
atgcaatggcctgtttccatcccaggggatggtctgatagatgtagttgttcaaagcgtc
gtaccgaggttgacaatggcaaatgcgattgccggcgccgaaaaaggggaggcgtattgg
atggattgccagtactactataaggtgtcacagttcatcgcagagaatttagacattgag
aatcaaccactttttacaatcgatggcgaagccttcccctttgaatcgtttcacgtcgag
gtacatactcgagttgcaaatcttcttagtctaaacggagactttttcacttctgatttc
ttgaagaagccaactggaaagaattaa

DBGET integrated database retrieval system