KEGG   Cryptococcus gattii: CGB_D6200CHelp
Entry
CGB_D6200C        CDS       T02232                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cgi  Cryptococcus gattii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CGB_D6200C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CGB_D6200C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1394333..1394454,1394504..1394626,1394675..1394849,1394898..1395113,1395164..1395355,1395417..1395493,1395556..1395588,1395640..1395898))
Genome map
AA seq 398 aa AA seqDB search
MYNRLGVSILLMAAASVVLGKSQEGGGYSQQLDPWNDEFANTPDLSFSGVASFAHLPHKR
CLDVKDAAFDIALLGVPFDSAVSFRPGARFGPYALRSGSRRQRPDRGYSSRLGVNPYSGD
LSILDCGDVPVTPFDPATAIKQINSAYRSLLHHPVESPEKMQTLNMQRGLDGNMHPRIIS
LGGDHTIVLPILDAVHEIYGPVSVIHFDAHVDTWNPHRYVGSVSVQADVNHGTFFWHAYE
KGFIKPNSSIHAGIRTRFGGPQDLEDDVTAGFDLIHTFDLDDFGIDWISEKIKTRIGGGP
VVISLDVDVMDPAFVPATGTPESGGWTSRELRRILHSLCGLNIVALDIVELSPAYDTNAE
ISAIAAADMVYDFLSILALGVEHREDAVSGTSALKDEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccggttgggcgtctccattcttcttatggcagctgcatcagttgtactaggc
aagagtcaagaaggcggcggttatagccaacagctcgacccttggaacgacgaatttgcg
aacactcccgacctgagtttcagtggagtagcaagctttgcccatcttccacataaaaga
tgcttggacgtcaaggatgcagcatttgatattgctttactaggggtgccttttgactct
gctgtttcgttccgaccaggcgcgaggtttggaccatacgctttgagaagtggctcacga
aggcagcgacctgatcgtggctacagtagcaggttaggggttaacccatactcaggtgat
ctctccattcttgattgtggagatgttcctgtcactccattcgatcctgcaactgccata
aagcaaatcaactcagcgtaccgatcattgctccatcatcctgttgaatcgccagaaaag
atgcaaacccttaacatgcagagaggtctcgatggaaatatgcacccccgaatcattagt
ttgggcggcgatcatacaattgttcttcctatcctcgatgctgttcatgaaatctatgga
ccagtctccgttattcattttgatgctcatgtcgacacatggaacccacacagatatgtt
ggtagtgtctcggtccaggctgacgttaaccacgggacattcttttggcacgcgtacgag
aaaggtttcataaagcctaattcatctattcacgctggcataaggacccgctttgggggg
cctcaagatttggaagatgatgtgactgccggatttgaccttatccatacttttgatctg
gatgactttggaatcgactggatctcagagaagattaaaaccagaatcggtggtggaccg
gtcgtgattagccttgacgtcgatgtcatggatcctgcctttgtacctgctactggcacc
ccggagtccggtggatggacttctcgagagcttcgtagaattcttcattcactttgtgga
ctcaatatcgtagcgttagacattgtggaactttctcctgcttacgataccaatgccgag
atatcggccattgctgcagcggacatggtgtacgattttttgtctatcctcgctctcggt
gtagagcatcgcgaagacgccgtcagtgggactagcgcattaaaggatgagctgtga

DBGET integrated database retrieval system