KEGG   Cryptococcus gattii: CGB_D7190WHelp
Entry
CGB_D7190W        CDS       T02232                                 

Definition
serine esterase
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cgi  Cryptococcus gattii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGB_D7190W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CGB_D7190W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(1608796..1609209,1609264..1610029,1610076..1611232,1611290..1611481,1611541..1611602,1611667..1611788,1611841..1611896,1611952..1611994,1612051..1612353,1612410..1612566,1612628..1612664,1612716..1612845,1612932..1612993,1613052..1613550,1613745..1613888,1613941..1614097,1614147..1614209,1614260..1614515)
Genome map
AA seq 1539 aa AA seqDB search
MVRMLQYSLTISLGFPHLLALFAGVLLALFFLIRYRYLTRYAQLKESALPPPSPPVLSSR
LLPLDGDGLGLPDSRSQTSSFHNYLDDFLSAIRVFGYLEKPVFHELSRHLQTRRLAAGDT
LEIGGGEFWCVVEGKVQVFAPDASPQGTPTPSSDTNTPIRPSFNGYHLLNEVSTGGTLSS
LFSILSLFTEDIKLSWRNSADDEGEEEQIFQGVAEQSSAKLRVKRANSDVSQLGPDCIGI
RAIDSTSLPESIDGHRDTSISRSCRERSSSIDAAGETVHRREGIHSSASLPLSSTEPSSP
RRSQSLRSSPRLNSATNLLSSQSEHLRSSMPRKAGLEIGSKALKGTIARATEDTTLAVIP
AAAFRKLTRKFPKASGTVVQVVLERFSRVTFMTAHKYLGLTREILQTESSLNRLVTHPLP
RSFYTGGGMQALRERFQPEARAKGSINYDSMKSSPNARVSSKDYFNYVPESPTVKAPSLP
AMTPKPFSPITHKTPLGQTATTPAKNECHNGGASVSSFNLSAASAISPDASLRHATPFIR
RTSAMRQQVAAGDLAMSVHNLPDQSGQAYYRPTAITPGLSKMDTWQQRYSNTWSMNDLPH
INGQPVDPQGDGESLLNETFDLKEAVLNSIAKSIGLYQESENNADTIARSSLAPSVSALS
TPNSPMFPPNSGTPLQGSTRSRPPHFGNVLDLINASAQNESVIEGMLREAAFNSRPDDEA
SSVSMSLRDSQGGASGGDRKIMKDLERHVEILFFKKDSVLVKEGERSPGMYYVIDGFLET
SLPVRSTNSNQENPNSTKGSQNGQSSFGSSSERPFKTALGLDTSKGKGLDDGSKKEETLF
TVKPGGIAGYLSSLCCTDSYVDITAKTDCFVGFLPHHTLERIIERRPIVLLTLAKRLLSL
LSPLVLHIDAALDWQQLNAGQVLYEKGDKSTDFYIVINGRLRAFTEKDGNMHVLREYGQN
DSIGELDVITAVDRSDTVHAIRDSELVRIPAALFDAISIKHPETTIQFMRLIAGRVRRAL
GDETNGRVPGLPTTDMNLKTVCVLGSTRNVPVAQFAGKLKNALEEIGASTSYLDQATVMR
HLGRHAFARIGKLKVAGWLADQEQHYRTVLYVADSPPASQWTLTCIRQADLVLIVSMGDD
PSLGEYELILLHDERTVAPGSTRQWLSNRPWIQTHYHVELPGVVTPARPIPPVHDAAAIA
AFKHLREQVETRIKKYRRLRPFTRPRRPAHMNDFARIARRLCGQQIGLVLGGGGARGISH
IGMLQALEEFGIPIDAIGGCSIGSFVGGLYARETDLLETAGRTKQFSGRMGSMWRILSDV
TYPFVSYTTGHEFNFWIPFFANSTNITHSRMEVHRTGYAWRYVRASMTLAGLLPPLSDNG
NLLVDGGYMDNTPIQPLRENGIRDIIVVDVGSIDDTSPRDYGDSVSGWWIFFNRLNPFYE
RRVLSMTEISSRLTYVSSVKTLEGVKATPGCHYIAMPVQQFDTLGGFKRFSEVLEIGLKA
GRETLKKWKEEGTLPTGLVDEAKGSKAVQRGNRLRRMSI
NT seq 4620 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtatgctccagtacagcctgaccatctcactcggctttccacatctccttgcc
ttatttgccggcgtgcttctcgcgctcttcttcctcataaggtaccgctaccttacacgc
tatgcccagttaaaggagtcagctttaccacctccgtctccacctgtactctctagccgc
ctattgcctttagacggggacgggcttggtttgccagattctaggtcgcaaacatcatca
tttcataattaccttgatgatttcctctcggctatcagagtatttggctatttggagaaa
ccagtattccatgagttgagtcgacatttgcaaactaggagacttgccgcgggcgatacg
ctagaaattggtggcggtgagttctggtgcgttgtggaaggcaaggtgcaagtgttcgct
ccggatgcttctccacagggaaccccaacgccttcttccgataccaacacccctataagg
ccttccttcaacggttatcatctccttaatgaagtatccacaggcggcactctctcatct
cttttctcgatcctttccctatttactgaagatataaagctttcatggagaaattctgca
gatgatgaaggcgaagaggagcaaatttttcaaggtgttgctgaacagtcatcggcgaag
ttgagggttaaaagggcaaattcagatgtaagccaactggggccggactgtattggaatc
cgtgcaatagattcgacctctctccctgaatcaatcgatggccatagagacacaagtatt
tcccgaagttgcagagaacgatcgtcttctatagacgctgctggtgaaacagttcacaga
agagaaggcattcattcaagcgcctccctgcctctttcaagtacggagccttcttctcca
cgacgttctcagtctcttcgttcttcacctcgcctgaactctgctacgaacttgttatcc
tctcaatctgagcacctacgatcttcgatgccaagaaaggcggggttagagatcggatca
aaagcgctgaaagggaccattgcacgggcgacggaggatacaacactcgcagtgattcct
gctgcagcttttcgaaagctaaccaggaaatttccgaaagccagcgggacagtcgtgcag
gttgtcttggaaaggtttagccgtgttacattcatgacagcacacaaatatctcggtttg
actcgcgaaattctacaaacggaatcatctcttaaccggctagtgactcatcccttacca
cgctcattttacactgggggaggtatgcaagctttgcgcgagcgcttccagccagaagcg
cgggcaaaagggagcataaactatgactcaatgaaatcctcgcctaacgccagagtgtct
agtaaagattacttcaactacgtgcctgaaagtccaactgtcaaagctccttccttacct
gcgatgacccccaaacccttctctcctatcactcataaaacccctttgggacagacagcg
acgactcctgctaaaaatgaatgccataatggcggtgcctcggtatcatcatttaatctc
tcagcagcttccgcaatcagtcctgatgcgagcttgcgccacgccactccattcatccgt
cgtacatcagccatgcgccaacaggtggctgctggtgatctcgcaatgtctgtgcataat
ctgcctgatcaatctggccaagcatactatcgtccgactgcgatcacccccggtctttca
aaaatggatacttggcaacagcgatattccaacacctggagtatgaatgatttaccccac
atcaacggtcaacctgttgatccccagggagatggcgaatcccttctgaatgagacgttc
gatttgaaagaagcggtcctcaacagtatagccaaatcaatcggactgtatcaagagtcc
gagaataacgctgacacgatcgctcgctcttccctggctccatcagtgagcgcgttgtca
actccaaactctcctatgtttcctcctaattccggcactccgttacaaggaagtacgcgt
tctcgccctccgcattttggcaacgttcttgacctgataaacgcatctgcccaaaacgag
agtgtcatcgagggtatgttgcgagaagccgctttcaactcccgtccagatgacgaagct
agtagtgtctctatgagcctccgtgactctcaaggaggagctagcggcggggataggaag
ataatgaaagatctggaacgacatgtagagattttgttcttcaagaaagatagcgtactg
gtaaaggaaggagagaggtcaccaggcatgtactatgtaatagatggtttcctggagacg
tctcttcctgttcgcagcacaaattccaaccaggagaatcctaattcaaccaaagggagc
caaaacggccagtcaagttttggaagttcgagtgaaaggcctttcaaaacggctctgggc
ctggatacttccaagggaaagggattagatgacgggtctaagaaggaggaaaccctattt
accgtcaagcctggtggtatcgctggatatctctcttccctttgctgtacagattcatat
gtcgatatcacggccaaaacagattgctttgtcggttttcttccccaccacactctggag
agaatcattgagcgacgaccaatcgttctgttgacattggcgaagagattgctatcccta
ttgtcgcctcttgtccttcacattgacgcggctctggattggcaacaattaaacgccgga
caagtcttatatgagaaaggcgataaatcaacagacttctacatcgtcattaatggtcgt
cttcgagcgttcactgaaaaggacggtaatatgcacgtgctccgtgaatatggacaaaat
gactctatcggtgaactcgatgtgataacggctgtcgatcgctcggacactgttcatgcc
attcgagattctgagcttgtgcgtattccggccgcattatttgatgcaatcagcatcaaa
caccccgaaacgacgattcagttcatgagattgatcgccggtagggtaagaagagctttg
ggagatgagacgaacgggcgagttcctggcttaccgactacagacatgaacctcaaaacg
gtgtgcgtacttggctctacgaggaatgttccagttgcgcagttcgctggtaaactcaaa
aatgcgttggaggagattggggcgtctacgtcgtacttagaccaggctaccgtgatgcgg
catctcggtaggcatgcgtttgcccgtattggtaaacttaaggtagcagggtggcttgcc
gatcaagaacaacattataggacagttctctatgttgccgactctcctccagccagccaa
tggactctgacttgcattcgccaggctgatctggttctgatcgtttccatgggcgatgac
ccttctctgggcgaatacgaattgattttgctccatgacgaacggactgttgctccagga
tcgacacgtcaatggctcagcaatcgaccatggatacaaacgcattatcacgtagaattg
cctggagttgtgacgcccgctcgccctatacccccagtgcacgatgcagcagccatcgca
gccttcaaacatcttcgcgagcaagtggaaacacgcataaagaagtatcgccgtctgcgg
ccatttactcgccctcgccgtcctgcccacatgaacgactttgctcgaatagctcgtcgt
ctatgtggccagcaaattggcctcgttcttgggggagggggcgcacgaggaatttctcat
attgggatgctacaggcccttgaagaatttggtatcccgatcgacgcaattggaggctgt
tcaattggcagctttgtagggggcttatacgcaagagaaactgatctattggagacagcg
gggaggactaagcaattctccgggaggatgggatcgatgtggaggattctaagcgatgtc
acttacccatttgtttcatatactaccggtcatgagttcaatttttggatacctttcttc
gccaattcgacgaatatcacacattcgcgcatggaagtgcatagaactggatatgcgtgg
agatacgttcgcgcttctatgactcttgccggtctattaccacctctttcggacaatggc
aatttacttgttgatggtggatacatggacaacactccaattcagcctttgcgtgagaat
ggtatccgtgatatcattgttgtggatgtcggttcaatagatgacacttctccgagagac
tatggtgactcagtctcaggatggtggatcttcttcaataggttgaacccgttttacgaa
aggagggtcctatcaatgacagaaatttcatcacgacttacctacgtctcgagtgttaag
acgttggagggggttaaagcaacccccggctgtcattacatcgccatgcctgttcaacaa
ttcgacactctaggcggctttaaacgtttctccgaagttctggaaatcggattgaaggct
ggccgagagacgttgaagaagtggaaagaggagggaacgttgccgactggtttggtagat
gaggctaaaggaagcaaagccgtgcagcgtggaaacaggctcaggcgaatgtcaatttga

DBGET integrated database retrieval system