KEGG   Cryptococcus gattii: CGB_D7370CHelp
Entry
CGB_D7370C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cgi  Cryptococcus gattii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CGB_D7370C
   03420 Nucleotide excision repair
    CGB_D7370C
   03430 Mismatch repair
    CGB_D7370C
   03440 Homologous recombination
    CGB_D7370C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1656652..1656858,1656924..1657089,1657144..1657286,1657345..1657455,1657517..1657608,1657661..1657670))
Genome map
AA seq 242 aa AA seqDB search
MNNYDGQNPYYSGAGGGYVAGGSPYGSQDSPSRKARGGNQTIRPVTVKQILEAQQVHPDA
DFTIDGVDVAQVLLVGSVRNMSTTATNVSYEIGDGTGYIDARVWLDSADDDSGKTTGVEQ
DHYVGLMGTIKVFGGKRHVSATHIRPITDANEVQHHLLKALYVSLILRGGAPGNAPKAAG
TRDDYNAGATTGATDQSAWSHLEPLQRRILEVMSSEGQGNDDGVHVTHIIKFLNGVDEND
FT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactacgacggtcaaaacccatactactcaggagccggcggagggtacgttgct
ggggggtcaccctatggcagccaagattcaccgagccgtaaagcaagaggagggaatcag
actattaggccggtgacagtgaaacaaattctcgaggctcagcaagttcatcccgatgcg
gatttcacgatagacggcgtggacgtagctcaagtccttttggtcggctctgtgcggaat
atgtcaacaacagcaacaaacgtttcctatgagattggggatggtacaggttatatcgat
gctcgcgtatggctcgattcagcagacgacgactcggggaagactacgggagttgaacag
gaccactatgttgggcttatgggcacaatcaaagtatttggcggcaaaaggcacgtgtca
gctactcatatccggcctataacagatgccaatgaagttcagcaccatctcctcaaagct
ctctatgttagtttgatactgagaggcggtgctcctggcaacgccccgaaagctgctggc
acccgcgatgactacaatgccggagcgactactggcgcgactgatcagtcggcctggtcg
catcttgagcctttgcagcgtagaattctggaagttatgtcgagcgaaggacagggcaat
gatgatggtgttcatgtgacccatatcatcaaattcctcaacggggttgatgaaaatgat
tttacgtga

DBGET integrated database retrieval system