KEGG   Cryptococcus gattii: CGB_D7820CHelp
Entry
CGB_D7820C        CDS       T02232                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cgi  Cryptococcus gattii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGB_D7820C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CGB_D7820C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1771965..1772358,1772411..1772634,1772690..1772725))
Genome map
AA seq 217 aa AA seqDB search
MSRPINPDVVNRPLVICGPSGTGKSTLLKTLFENQPNTFGFSVSHTTRKPRPGEENGREY
HFVTKEEFMEGVGRGEFLEWAEFGGNCYGTTFAALSALHPRRCILDIELQGVLQLKAKAP
LQTPPLEPVFLFLSPPSISQLKSRLSGRGTETDSSIRKRLDAAKQELKYAKEGKYDVYVV
NDDLKVAGEKLEKVAMGWEGWNTCGDVLPELNLAELD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggcccatcaacccagacgtcgtcaaccgcccactcgttatttgcggcccttct
ggtacagggaaatctactcttctcaagactctttttgagaaccagcccaatacctttggt
ttttccgtctcccataccactcgaaagcctaggcccggagaggaaaatggtcgagaatac
cacttcgtcaccaaggaagagtttatggagggtgttggcaggggcgaatttttggaatgg
gccgaattcggcggcaactgctacggaaccacctttgctgctttgagcgcccttcacccc
cgccgatgcattctcgacatcgaactgcaaggtgtccttcagctaaaggccaaagcccca
ctccagaccccaccccttgaacccgtgtttctcttcctttcccctccttccatttctcaa
cttaaatcccgtttgtctgggcgaggtaccgagactgactcctccattcgaaagaggctt
gatgccgccaagcaggagctgaaatacgcgaaggagggcaaatatgacgtttacgtcgtc
aacgatgatctaaaggtggctggcgaaaagcttgagaaagttgcgatgggttgggaaggt
tggaacacttgcggtgatgtcctgccagagttgaacttggctgaacttgactaa

DBGET integrated database retrieval system