KEGG   Cryptococcus gattii: CGB_D8370WHelp
Entry
CGB_D8370W        CDS       T02232                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cgi  Cryptococcus gattii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CGB_D8370W
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CGB_D8370W
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CGB_D8370W
Lipid biosynthesis proteins [BR:cgi01004]
 Desaturase
  First
   CGB_D8370W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:join(1902176..1902308,1902359..1902590,1902639..1903089,1903150..1904106)
Genome map
AA seq 590 aa AA seqDB search
MSAAVLPMTPPLEKEESELVHRRPSPADELTPPHTPEQNPCKSTNGKGIDPIDPSLLPSD
RHIPDNYVSYTIANQKYLPPITWKNLIHNIQWISFLALTVTPSLAIYGIFTTAWNTKTAI
WSVIYYFITGLGITAGYHRLWAHRAYNASIPLQYVLATAGSGAVEGSIKWWCRGHRAHHR
YTDTDLDPYSAEKGFFWSHVGWMLVKPRGKIGVADVSDLSKNRVVKWQHRNYIPLILGMG
FVFPTVVAGLGWGDWRGGFFFAGAARLCFVHHSTFCVNSLAHWLGEQPFDNKHSPRDHII
TALCTIGEGYHNFHHQFPQDFRNAIKWFQYDPTKWFIWTMSTLGLASHLKRFPDNEVKKG
QYTMKLQLLKEQADELEWPKSSNDLPVISWDDFKAEAKERSLVAIHGFIHDCSSFVEDHP
GGAHLIKRAIGTDATTAFFGGVYDHSNAAHNLLAMMRVGILDGGMEVEHLKRRPAESAVS
SVTNSPVSSASASSVDIQSLADDDFRLDQTQLNSQGPKPKAPFGQPQAQVADRWTLSVPP
SEKLRIVQTVPEMRPGLLTHRSVGKLDKVTKADVGGEANEFSGNEPVAAA
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgccgttctgcccatgacccctcctctcgaaaaggaagagagcgagcttgtt
cacaggcggccctcccctgctgatgagctcactccgcctcatactcccgaacaaaacccc
tgcaagtcaaccaacggcaagggaattgaccctattgacccctctctcctgccgtctgac
cgacacattcctgacaactacgtctcctacactatcgccaaccagaaatacctccctcct
atcacatggaagaacttaatccacaacatccagtggatctctttcctcgcactcactgtt
actccttccctcgccatatacggcattttcaccaccgcctggaataccaagactgccatt
tggagtgttatctactacttcatcactggcctcggtattaccgccggttaccaccgactt
tgggctcaccgtgcctacaatgccagtattcctctccaatatgttcttgccactgccggt
agcggtgctgttgaaggttccatcaagtggtggtgccgaggtcaccgagcccatcaccgt
tacaccgacactgatcttgacccctactccgccgagaagggcttcttctggtcccacgtt
ggatggatgttggtcaagccccgaggaaagatcggagtcgccgatgtcagtgatttgagc
aagaacagggttgtgaagtggcaacacaggaactacattcccttgatcttgggtatgggt
ttcgtcttccctaccgttgtcgctggtcttggctggggagactggaggggtggtttcttc
tttgctggcgctgccaggttgtgctttgttcaccactctactttctgtgtcaactctctt
gcccactggcttggtgagcagcccttcgataacaagcactctcctcgagaccatatcatt
actgctctttgcactattggcgaaggttaccacaacttccaccatcaattccctcaggac
ttccgaaacgctatcaagtggttccagtacgaccccaccaagtggttcatttggaccatg
tctacgcttggtcttgcctcccacttgaagcgtttccccgacaacgaggttaagaagggt
cagtacaccatgaaattgcagcttcttaaggagcaggccgatgagcttgaatggcccaag
tctagcaacgaccttcctgtcatcagctgggacgatttcaaggctgaagccaaggaacgc
tctcttgttgctatccacggtttcattcacgactgttcttccttcgttgaggaccaccct
ggtggtgcccacctcatcaagcgtgctattggtactgatgccactacagccttctttggt
ggtgtctacgatcactccaacgctgcacacaacttgctcgctatgatgcgtgtcggtatc
cttgatggtggtatggaagtcgagcacctcaagcgacgtcccgccgagtctgcagtctcc
tctgtcaccaactctcccgtttcttccgcctctgcctcctctgtcgacatccaatctctc
gccgatgacgacttccgtcttgaccagactcagctcaactctcagggccccaagcccaag
gctcctttcggtcagcctcaggctcaggttgctgacaggtggacactttccgtgccccct
agtgagaagttgaggatcgtccagactgtgcccgagatgaggccgggattgttgactcac
cgatcggtcggaaagctcgacaaggtcaccaaggctgatgtcggcggtgaggccaacgaa
tttagcgggaatgagcctgtggctgcggcttaa

DBGET integrated database retrieval system