KEGG   Cryptococcus gattii: CGB_D8480CHelp
Entry
CGB_D8480C        CDS       T02232                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cgi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cgi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cgi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cgi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cgi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1925222..1925666,1925749..1926420,1926487..1927441,1927508..1928008,1928085..1928256))
Genome map
AA seq 914 aa AA seqDB search
MSDSSAVPPLPKDPEGITEQLQSVATPPPPPRAHKPPRQKKIAVLTSGGDSAGMNSAVRA
VVRQSIARGCQAYIIREGWEGLVRGNTSDPTPAPTAPQSPTLSPSSKSVTFSSLPPSQQL
DKLTSTLNKESLTNEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVDELASHGMQNL
AIADHEDEKGRTLKNKYIVRVGWDDVRGWQSEGGTLIGSSRCPAFRTREGRLQAANNLIH
FGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTDNRISDEQREAYQHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKV
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVCQTAPKENRLRIG
IIHVGAPAGGMNAATRQAVRFCHSRGHTPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRHSLDGLLIIGGFEAFHSIVLLSQNRSNYPAFQIPMIH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGQSGYIATMG
ALAVGAVLVYTPEMGISLTLLQEDVEFLIKRYSLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHACPNSQATHH
KPKPAHLTHGSAKCSVKDTAAMIAIIGSKVVYASMEDVLKVTDMKLRRGTDEWWSDCKQL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcatcggccgttcccccgctccccaaggatccagaaggcatcacagagcag
cttcagtctgtcgctactccacctcctcctccgcgggcacataagcctccaagacagaag
aagattgcagtcttgaccagcggtggtgactcggctggtatgaactctgccgttcgagca
gtagtccgccagtccatcgcccgtggctgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccgaccccactcctgcacctaccgcgccccaatccccc
accctttccccatcatccaagagtgtcaccttctcctctttacctccttcccagcagctc
gataaactcacctctactttgaacaaggaatcactcaccaatgaagtctccttctcggac
ccgaacgaggtcaccccgctcgaggatacacctctcagtttcgggtacggccagcttttg
agggatggagcgggtgaaggcgatgtggatgagttggcgtcgcatgggatgcaaaacttg
gcgattgccgatcacgaagatgaaaagggtagaacgttgaagaacaagtatattgtcagg
gttggatgggatgatgtcaggggttggcaaagtgaaggcggtaccctcatcggtagttct
cgatgccctgctttccgcacgagggaaggccgactccaagccgctaacaaccttatccat
ttcggtatcgactgtctcgccgtttgcggtggtgacggttccttgaccggtgccgacaag
ctccgtggcgaatggcccagcttggtggaagagctctacactgacaacaggatttcagac
gagcagagggaagcttaccagcacctcaacattgtcggactcgttggatcgattgacaat
gatatggccttgaccgatttgaccatcggtgcgcttaccgctctgcaccgaatttgtgaa
tccatcgattccatctcttccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggccgacactgcggttggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcctaaatgcgaggactgggagacggagatgtgtgacctc
ttgcaagcgcatcgaaaagtcggcaaacgcaagtcaatcgtcatcgtcgccgaaggcgcc
ctcgataggaacttgaaacccatcaagccagactatgtgaaaaagatcctcgtcgagcgt
ctcggtctcgatacacgtgtcaccaccctcggccatacccagcgtggaggtaaaccctgc
gcgtttgacaggatcttgcccactctccaaggtgttgaggccgttcaaacgttgttgagc
gcgacacccgagacaccttcgtatatgattggtatccaggaaaacaagattaccaaagtc
cctctgctcgaggctgtggcgcgcacgcagatggtggccgaagcgattgagaacagagat
ttcgcaaaggccatgtctttcagagactcggaattccgagaaatgctccaggctttccag
attagctcgtctcttgatgtctgccagactgctcccaaagagaatcgattgaggatcggt
atcatccatgtcggtgcgcctgctggtggtatgaatgctgctacccgacaagccgtccga
ttctgtcacagccgaggccacaccccagtcgccatctataacggtttcgaaggtctcttg
gacgacaacgtctctgagctctcctggctccgagtcgactcatggaccacccgtggcggt
tccgagctcggtacgaaccgatctttaccttccatcgatatcggctccgtcgctgccggt
ttccagcgacactccctggacggcttgttgatcattggtggtttcgaagctttccactcg
atcgtcctcctctcgcaaaaccgatccaactaccccgccttccagatccccatgattcat
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtagaagcttgtgatgccatcaagcagagtgcctcggccagtagg
aacagggtgtttgtggtagagacccaaggtggacagagtgggtatatcgctacgatgggt
gcgctcgcagttggagctgtcttggtgtacacgcccgagatggggatttccttgacgctt
ttgcaagaggatgtcgagttcttgatcaagaggtacagcttggatgagaagggaaagagt
gagggtaggttggttatcaaagccgaaaagtcttcctctgtgtacaccaccgaaactctt
accaagatcttcaaggaagaaggtaaagacctcttcgacgcccgttctgcttctctcggc
cacaccctccaaggtggtgtcccttctcctctcgaccgaactcgtgccgcccgtctctca
ttgaggtgcatgcaattcctcgaagaacacgcttgccccaactcccaagccacgcaccac
aagcctaagcctgcccacctcacccatggaagtgcaaaatgctcggtcaaggatacggcg
gcgatgattgcgatcatcggtagcaaggttgtgtacgcgtcgatggaggatgtgttgaag
gtgacggatatgaagttgaggaggggaacggatgagtggtggagtgattgtaagcagttg
gcggaaacgatgggtggaaggactggtttaatggccaagcattaa

DBGET integrated database retrieval system