KEGG   Cryptococcus gattii: CGB_D8480CHelp
Entry
CGB_D8480C        CDS       T02232                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGB_D8480C
   01230 Biosynthesis of amino acids
    CGB_D8480C
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_D8480C
   00030 Pentose phosphate pathway
    CGB_D8480C
   00051 Fructose and mannose metabolism
    CGB_D8480C
   00052 Galactose metabolism
    CGB_D8480C
  Energy metabolism
   00680 Methane metabolism
    CGB_D8480C
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CGB_D8480C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CGB_D8480C
Protein phosphatases and associated proteins [BR:cgi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CGB_D8480C
Messenger RNA biogenesis [BR:cgi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CGB_D8480C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(join(1925222..1925666,1925749..1926420,1926487..1927441,1927508..1928008,1928085..1928256))
Genome map
AA seq 914 aa AA seqDB search
MSDSSAVPPLPKDPEGITEQLQSVATPPPPPRAHKPPRQKKIAVLTSGGDSAGMNSAVRA
VVRQSIARGCQAYIIREGWEGLVRGNTSDPTPAPTAPQSPTLSPSSKSVTFSSLPPSQQL
DKLTSTLNKESLTNEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVDELASHGMQNL
AIADHEDEKGRTLKNKYIVRVGWDDVRGWQSEGGTLIGSSRCPAFRTREGRLQAANNLIH
FGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTDNRISDEQREAYQHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKV
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVCQTAPKENRLRIG
IIHVGAPAGGMNAATRQAVRFCHSRGHTPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRHSLDGLLIIGGFEAFHSIVLLSQNRSNYPAFQIPMIH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGQSGYIATMG
ALAVGAVLVYTPEMGISLTLLQEDVEFLIKRYSLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHACPNSQATHH
KPKPAHLTHGSAKCSVKDTAAMIAIIGSKVVYASMEDVLKVTDMKLRRGTDEWWSDCKQL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcatcggccgttcccccgctccccaaggatccagaaggcatcacagagcag
cttcagtctgtcgctactccacctcctcctccgcgggcacataagcctccaagacagaag
aagattgcagtcttgaccagcggtggtgactcggctggtatgaactctgccgttcgagca
gtagtccgccagtccatcgcccgtggctgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccgaccccactcctgcacctaccgcgccccaatccccc
accctttccccatcatccaagagtgtcaccttctcctctttacctccttcccagcagctc
gataaactcacctctactttgaacaaggaatcactcaccaatgaagtctccttctcggac
ccgaacgaggtcaccccgctcgaggatacacctctcagtttcgggtacggccagcttttg
agggatggagcgggtgaaggcgatgtggatgagttggcgtcgcatgggatgcaaaacttg
gcgattgccgatcacgaagatgaaaagggtagaacgttgaagaacaagtatattgtcagg
gttggatgggatgatgtcaggggttggcaaagtgaaggcggtaccctcatcggtagttct
cgatgccctgctttccgcacgagggaaggccgactccaagccgctaacaaccttatccat
ttcggtatcgactgtctcgccgtttgcggtggtgacggttccttgaccggtgccgacaag
ctccgtggcgaatggcccagcttggtggaagagctctacactgacaacaggatttcagac
gagcagagggaagcttaccagcacctcaacattgtcggactcgttggatcgattgacaat
gatatggccttgaccgatttgaccatcggtgcgcttaccgctctgcaccgaatttgtgaa
tccatcgattccatctcttccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggccgacactgcggttggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcctaaatgcgaggactgggagacggagatgtgtgacctc
ttgcaagcgcatcgaaaagtcggcaaacgcaagtcaatcgtcatcgtcgccgaaggcgcc
ctcgataggaacttgaaacccatcaagccagactatgtgaaaaagatcctcgtcgagcgt
ctcggtctcgatacacgtgtcaccaccctcggccatacccagcgtggaggtaaaccctgc
gcgtttgacaggatcttgcccactctccaaggtgttgaggccgttcaaacgttgttgagc
gcgacacccgagacaccttcgtatatgattggtatccaggaaaacaagattaccaaagtc
cctctgctcgaggctgtggcgcgcacgcagatggtggccgaagcgattgagaacagagat
ttcgcaaaggccatgtctttcagagactcggaattccgagaaatgctccaggctttccag
attagctcgtctcttgatgtctgccagactgctcccaaagagaatcgattgaggatcggt
atcatccatgtcggtgcgcctgctggtggtatgaatgctgctacccgacaagccgtccga
ttctgtcacagccgaggccacaccccagtcgccatctataacggtttcgaaggtctcttg
gacgacaacgtctctgagctctcctggctccgagtcgactcatggaccacccgtggcggt
tccgagctcggtacgaaccgatctttaccttccatcgatatcggctccgtcgctgccggt
ttccagcgacactccctggacggcttgttgatcattggtggtttcgaagctttccactcg
atcgtcctcctctcgcaaaaccgatccaactaccccgccttccagatccccatgattcat
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtagaagcttgtgatgccatcaagcagagtgcctcggccagtagg
aacagggtgtttgtggtagagacccaaggtggacagagtgggtatatcgctacgatgggt
gcgctcgcagttggagctgtcttggtgtacacgcccgagatggggatttccttgacgctt
ttgcaagaggatgtcgagttcttgatcaagaggtacagcttggatgagaagggaaagagt
gagggtaggttggttatcaaagccgaaaagtcttcctctgtgtacaccaccgaaactctt
accaagatcttcaaggaagaaggtaaagacctcttcgacgcccgttctgcttctctcggc
cacaccctccaaggtggtgtcccttctcctctcgaccgaactcgtgccgcccgtctctca
ttgaggtgcatgcaattcctcgaagaacacgcttgccccaactcccaagccacgcaccac
aagcctaagcctgcccacctcacccatggaagtgcaaaatgctcggtcaaggatacggcg
gcgatgattgcgatcatcggtagcaaggttgtgtacgcgtcgatggaggatgtgttgaag
gtgacggatatgaagttgaggaggggaacggatgagtggtggagtgattgtaagcagttg
gcggaaacgatgggtggaaggactggtttaatggccaagcattaa

DBGET integrated database retrieval system