KEGG   Cryptococcus gattii: CGB_E0120CHelp
Entry
CGB_E0120C        CDS       T02232                                 

Definition
structural constituent of nuclear pore
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CGB_E0120C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(32965..33102,33152..33390,33446..33536,33582..33718,33775..34078,34135..34284,34349..34626,34678..38512,38563..39341,39423..39627,39709..39747))
Genome map
AA seq 2064 aa AA seqDB search
MLRKCRKKLHENWDMMSALPIQQWDPDQFSDLQHILARVLTQPTTSSLRKLHAALVQARP
WLLNLTALPGVNDKDKQFVEHKLANGTSINVTGDLLNATNALSSFLSISHLFSSILSLQA
ETHRAVYPSRSTPEISIYLLHRWQTDLLDFLKELLRVVLEQGDMMGSGWEGLKEFVEDLL
GAKVTLADGSGKEGTLVDQILSQLSVLQTKISSLLSTSSSGQGYELQQFRLTALRAEQNK
LAGILALIAEGGRLGRGQVIRVLKWLAKVERMDAVVGLVAASVWAAWKPLEVLDASDARY
DVSLSVGVVTSFMRIELMENEKVAEDWCHDIKFLKLASSLALQERWAIPRLRESIKLSWS
LFYLSCIKHDASVIQTGIDQHEMEGWLHDSIANGAFQFLHEMVITIRQERGWDEPDETKE
AGTDSLVTVALASDKANDEFLFKQLQDIVNILAGKKQFLRNLRNREEDALIRRSSIAPSH
TNANADTSVYNYQTFLRLFASVYRSLPPDSALDLWENPTFTGTILDTRGGFPGPAFWEML
SSISSGPSCAAVSYERLKDTRLPWTALFKFYQHYIDIMPHAYEPIKTTRNPPPSLDPMPT
EEVEICKGWTEVLTTIVRWSPAARGALLQMKPHPIGVLWDFVNCENVPLHLKAAILNAIT
AFTSRSSQSEAQASITMHDPMDDEVLAQSVGFYEKISYRDPNTDVRYLEGGRIPPPVGWL
IRMGFLEGEAGRYELSRAYVNFLTALLPSLSSLPTSSASGTASISSALGKSTLSSTRPRL
TNTLRRGTFQVIDGILLSLKMRRYVRDSERWEVLDGLTAFLERAVLGFDMSELLNLGSGS
GSISGVSSVGGPGGSGRGIGQIALELSEEPGFIVILRLLSERDIFAVLAEVLDSAASLGG
NGERKKIVSKVLRQVLRIYHRVMELQLVFADVLLLALTDPSRNPAHTLKRPYGLQPLDNH
LLAHLTNVNNIALLIGDDDPAISYLSTKLIASLSNSPVFNRSDLFQGEYKGEVNRLAGVL
DVSDDSIRILQGFVRRLDVEGEDPEQGVEAVEEIALHGDIEQVKEELPMVIRSVILDILI
DGTSPSNTSPNIAHFLLGYDFRHRHFSFSSEEGCLQIVLKQMLEGAELAGSTGEGDGILE
VHPQLGAKSAELVYQLFSGVLTGKATLGYAMSVTGYSARQLASLPRQCPEWQGLIPQGSS
ISAPSTSTTGMGWAVTRDTKVETSSETLVAYLEFQRWIISSASLEIFIYDGHGASASRIA
QILFNGQAQGLLDNGDVEDGEGEDHLPPLLIDLLNSVDVRWIEESIDNRQLEFYASFDFD
AYKRPDVNWWDIKALAAGLAAFKKQLERQGAITQASVPGVDAEAEYVLSRLAGKNRETDV
AIAKGNFLAAWNELLKVGLTLLFVRHITEDHQEAILFDLLEGLLTRLDGEIDLAPGVEDL
LCESSLVVMTTLVSVLQKFEGVNLPVEQLGAVLAKVVDAATRPGSTETARGNLYAAITQY
LQLIIPANSNNPDDRSISGSTVDPLTSFSSTTMLQRITLQIFAAKKERLVPGVCRDAMDD
RDVWKTECFALLGGIVGICQGERDRHVVAPLVSNGYLPLFVRSIKEREGALMECLAPDAE
TLHAYWVFEAKIAFLIALASTRKGSEDLLDAGVFEIFATCGFINIQLNEGMLDESTGGEI
VERQHRVLVASLQLLARVLSSLHKSARSGAGHAISFLNAHREAILALVREPQQNLTVTAL
DECRLVVSVLAMVVHKVPSEDLYSPSSFGAFHLAVLSAAAHAFDRNTWVEVAEEDSKSTF
SLILVAHSSAYQPSTTVESQMVLLNQVLLAFLIAATNGLKAGSGNPVFITGVRRSHGSAV
KYIASAPSLQMAVNLLSDLAETTQEVSNQYEVILDRMQDGSDLEEEDVEQKLRNEFIGDA
PLSDDLIRVAFVARSQMLFNMIESLLLLIWRHLLFYANDVRGSLAPIRPENLSPSLSSFA
MSQQAQMEASRSNAGTMKMLERVAAGLRGTLIRLDDMEVNLELRRLVTGGSARGDAYYGM
LVRRLKEMVAGLVGEREIMEDDQE
NT seq 6195 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtaaatgtagaaagaagctgcacgagaattgggacatgatgtccgccctaccc
atacagcaatgggacccagaccagttctcagatctgcaacatatactcgcccgcgtactc
acacagccaaccacttcctctttgcgaaaactccacgcagctcttgtgcaggcgagacca
tggttgttgaatcttactgctttaccgggtgttaatgacaaggataagcagtttgtcgaa
cacaaacttgccaatgggacatcaataaacgtcactggcgatttgctcaacgcaacaaac
gctctctcatccttcctctctatctcacatctcttttcctccatcctctctcttcaagca
gaaacacaccgcgccgtctacccttcacgctccactccagagatttcgatctacttgcta
cacagatggcagaccgatttactcgatttcttgaaagaattgttaagggtggtgttggag
cagggggatatgatggggagtgggtgggagggattgaaagagtttgtggaagatttgttg
ggggccaaagtgaccctggcagatggcagtgggaaagaaggtaccttggtagaccagatc
ctcagccaactatctgttcttcaaacgaaaatctcgtccctcctgtcaacttcatcttcg
ggacagggatatgaactccaacagttccgacttacagctcttcgagcagaacagaacaag
ttggcagggatacttgcgttgattgcggaaggaggtagattggggagaggacaggtcata
agagttttgaaatggttggcaaaggtggaaaggatggatgctgtagtaggtctggtggcg
gcgagcgtttgggcggcgtggaaacctctggaagtgctggatgcgtcggacgcgaggtat
gatgtgagtttatccgttggtgtggttacaagttttatgagaatagagctgatggagaat
gaaaaggttgcggaggattggtgtcacgatatcaagttcctcaagcttgcctcaagtctt
gccctccaagaacgatgggcgattcctcgtcttcgagaatccattaaactttcctggtct
cttttctacttatcctgcatcaagcacgacgccagcgtcatccaaacaggcatcgatcaa
catgagatggaagggtggctgcacgactctatcgcaaacggtgcattccaattcctgcac
gagatggttatcaccatccgccaggaacggggctgggatgaacctgacgagaccaaggaa
gccggcacggactcgcttgtcacggttgcgctcgcgtctgataaagcgaatgacgagttt
ttgttcaaacagctgcaggatatagttaatatcctcgcggggaaaaagcagtttttgcgg
aatttgcggaatagggaggaagacgctttgattcgacgatcgtctatcgctccatcgcac
acaaacgccaatgccgacaccagcgtttataattaccaaactttcctccgcctcttcgct
tctgtctaccgctccctccctcctgattctgccctcgatttgtgggaaaacccgacattc
actggtaccattctcgatactcgtggtggtttccccggtccagccttttgggaaatgtta
tcttcaatctcctccggtccttcgtgcgcggctgtaagctacgaaaggctcaaagacacc
cgtcttccttggaccgccctcttcaagttctatcaacattacatagacatcatgcctcac
gcgtatgaaccaatcaaaactacacgtaatcccccgccatcattagaccctatgccgaca
gaagaggtggaaatatgtaaaggatggacggaagtgttgaccacaatagtgaggtggtcg
cccgcagcgcggggtgcgttactgcagatgaaaccgcacccaatcggtgtgctctgggat
ttcgtgaattgcgagaatgtaccactccatttaaaggcggccatactcaacgctatcact
gcttttacttctcgctcttctcaatctgaggcgcaagcttcgattaccatgcacgatccc
atggacgacgaagtcctcgcgcagtcagtagggttctacgagaagatttcgtaccgcgat
ccaaatacggatgtgaggtacttggaaggagggaggataccacctccagtagggtggtta
attaggatggggttcttggagggggaagcggggagatacgagctgagtcgtgcttatgtc
aatttcctcactgcactcttaccttctctctcttccttgccgacatcctctgcatctgga
actgcctcaatctcatccgcattagggaaatccaccttatcgtctactcgtcccaggttg
accaacactctgagacggggaaccttccaagttatcgatgggatattactttcactcaag
atgaggagatatgtcagagattcagaaagatgggaggtattggacgggttgacggcattt
ttggagagggcggtgctaggattcgatatgagtgaacttctgaacctcggctctgggtct
ggctccatctctggcgtgagctctgttggggggccaggaggatcaggaaggggaattgga
cagatcgccctggaattgagtgaagaaccgggctttatcgtcatcctccgtctgttgagc
gaacgtgatatttttgcggtactcgcagaggttttagacagtgccgcttctttggggggg
aacggagaaaggaagaagattgtgagcaaggtcttgaggcaggtattgaggatctaccac
cgtgtaatggaacttcaactcgtctttgccgacgtactcctactcgctcttaccgatcct
tctcgaaacccggcacatacgctgaaacgaccctacggccttcaaccgctggataaccat
ctactggcacatttgacaaacgtgaacaatatcgcgttgttgataggcgacgatgacccc
gcgatctcgtacctctctactaaacttatcgcgtcgctctccaattcgccagtgttcaat
cgatcggacttgttccaaggggagtacaagggggaggtgaatcggttggcgggggtgttg
gatgtttcggatgattcaatcaggattctgcaaggatttgtgaggaggttagatgtggaa
ggtgaggatcctgagcaaggtgtggaggcggtagaggagatagcgttacatggtgatatc
gagcaggtcaaggaagaattacccatggtcatccgttcagttatcctcgacatcctcatt
gacggtacatcgccttccaacacctcacctaacatcgcccatttccttcttggatatgat
ttccgtcatcgccacttctcattctcctctgaagaaggatgtctccagattgtgttgaag
cagatgcttgaaggtgccgagttggccggttcgacgggtgaaggtgatggaattttggag
gtacatcctcagttgggagcgaagagtgccgagctggtgtaccagctcttctcaggagta
ttaactggaaaggcgacattggggtatgcaatgtctgtcacgggttattccgcaagacaa
ctcgcttctttgccccgccaatgtcccgaatggcaaggcctcattccgcagggcagttct
atttctgccccctccacttccacgacaggaatgggatgggctgtgacaagggatacaaag
gtagagactagctcggagacgttggtggcctaccttgaattccaacgatggattatctca
agtgcctctctggagattttcatttacgacggtcatggtgcatcggcttctcgtatcgct
cagattcttttcaacggccaagcgcaaggacttctcgataatggagacgtagaggatggt
gaaggggaagaccatcttcctccgcttttgatcgacctactcaactcggttgatgtgcgg
tggatcgaagagtctatcgataaccgccaacttgaattctatgcgtcatttgatttcgat
gcctacaaacgaccggatgtgaattggtgggatattaaggctctcgcagctggtttggcg
gcatttaagaaacagctcgagaggcagggagcgatcactcaggcgtcggtcccaggtgta
gatgccgaggcggagtacgtgctcagtcgtctggcaggaaagaacagggaaaccgatgta
gcgattgcaaagggcaacttccttgctgcttggaatgaattgctaaaggtggggttaacc
ttgctcttcgttagacatatcacagaagatcaccaagaagctatcctcttcgaccttctt
gaaggtttacttactcgacttgacggagagattgaccttgctccgggtgtggaggatcta
ttatgtgaatcgagcttggtggtgatgacaacattggtcagcgtgctccaaaagtttgaa
ggagtcaatcttccagtggaacagctcggagcggtattggcaaaggttgtagatgccgct
acgaggccaggatcgacggaaactgcaaggggaaacttgtatgccgcgatcacacaatac
ctgcagctcatcatccctgccaactctaacaatcccgatgatcgatccatctccggctca
acagttgaccctctcacttctttttcgagtactaccatgcttcagcgcattacactccaa
atttttgcggcaaagaaagagagacttgtgcccggagtatgtagagacgccatggatgac
cgggatgtatggaaaacggagtgctttgcattattgggtggtatcgtcggtatctgccag
ggagagagggataggcacgttgttgcgcctttagtcagcaatgggtacctgccgttgttt
gtgaggagtattaaggaaagggaaggggcattgatggaatgtcttgcacctgatgctgaa
accctccacgcctactgggtgtttgaagccaagatcgccttcctgatcgcgctggcatcc
actcgcaaaggctctgaagatctcctcgacgctggcgtctttgagatatttgccacgtgc
ggcttcatcaatatccagttgaacgagggcatgctggatgaaagcactggtggagaaatt
gtggagaggcagcatcgagtacttgtggccagtctacagttgctcgctcgagtgttgtcg
agcttgcacaagtctgcaagatcaggagctggacatgccataagtttcctcaacgctcac
cgcgaagcgatccttgcgctggtccgtgaacctcaacaaaaccttacagtgaccgcgctt
gatgaatgtcgattggtggtgtccgttttggccatggttgtgcacaaggttccttcagag
gatttatattccccatcaagctttggcgctttccacctcgctgtgttgtctgctgctgct
cacgctttcgacaggaacacttgggtcgaagttgctgaggaggacagcaaaagtacgttc
tccctcattcttgttgctcattcttctgcttaccaaccgtcgacgacagttgagtcacag
atggttcttcttaaccaagttctgcttgccttcctcatcgctgctacaaatggcttaaag
gcaggatctgggaaccccgtgtttatcaccggtgtacggaggagtcatggcagcgctgtc
aaatacatcgcctctgctccttcgctacaaatggccgtcaatcttctatctgaccttgcg
gagacgacgcaagaggtgtctaaccagtatgaggtgatccttgatcgaatgcaggatgga
agcgatctggaagaagaggacgtcgaacagaagcttcgtaatgagttcattggtgatgcc
ccattgtcggatgatttgatcagagttgcctttgttgcaagaagccaaatgttgttcaat
atgattgaatctctccttcttctcatatggcgacatctcttattctatgccaacgacgtt
cgaggatctcttgcccctatccggccagagaacctctccccttcactcagctcattcgcc
atgtctcaacaagcacagatggaagcttcaaggtcaaatgctgggacaatgaagatgctg
gaaagagtagcggcaggcctgagaggaacgctgatacgattggatgatatggaggttaac
cttgaattgaggagactcgtgacggggggaagtgcaaggggtgatgcatattacggcatg
cttgtaaggagattaaaggagatggttgcgggcctagtcggtgaaagagaaatcatggag
gatgaccaagagtaa

DBGET integrated database retrieval system