KEGG   Cryptococcus gattii: CGB_E0450WHelp
Entry
CGB_E0450W        CDS       T02232                                 

Definition
mitogen-activated protein (MAP) kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CGB_E0450W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CGB_E0450W
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CGB_E0450W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:join(121627..121718,121789..121905,121980..122058,122109..122128,122183..122243,122306..122401,122497..122620,122681..122743,122802..122843,122910..122947,122998..123045,123113..123204,123270..123327,123383..123485,123551..123618)
Genome map
AA seq 366 aa AA seqDB search
MTIDQSQISFNVPSTYKLEEIVGEGAYGLVVAGTHLPSGTRVAIKRITPFDHTMFCQRTL
REVKLLRHFHHENIISILDLIQPESYEMFNEVYLVQELMETDLHRVIRSQELSDDHCQYF
VYQTLRGLKALHSADVLHRDLKPSNLLLNANCDLKICDFGLARSSAKPPPGTSDGGQGFM
TEYVATRWYRAPEVMLSFQEYTKAIDLWSVGCILAEMINGKPLFPGRDYHHQLSLILQVL
GTPTMDDFNEITSQRSKDYLRALEFTRRQDFSAICPKAMPAAVDLLKRTLTFSPSKRITV
EEALTHPYVEAYHDPQDEPNAEPLKPGFFDFEFHQEKLSRDQWKRMIYDEVQDPVPTILS
QWTANH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaccaaagtcaaatcagcttcaatgttccttctacttataagctcgaagag
atcgtaggggaaggtgcctatggtcttgttgtagctggtacccatcttccctctgggact
cgagtcgctatcaagcgtattacgccatttgaccacactatgttttgtcagcgaacgttg
agagaggttaagctccttagacattttcatcatgaaaatatcatctccatcctcgacctg
attcagcccgaaagttatgagatgttcaacgaagtctatctcgtccaggaacttatggag
actgatttgcaccgagtgattagaagtcaggaattatcagacgaccactgccaatacttt
gtctatcaaactctacgtggtttgaaagccctccattctgccgacgtccttcaccgtgat
cttaaaccttcaaaccttctgttaaacgccaactgcgatcttaaaatctgcgattttggt
ctcgcccgatcatctgccaagcctccacctggcacatcagacggaggacagggattcatg
acggaatatgtcgcaacaaggtggtatagagcgcccgaagtcatgttgtcgttccaagaa
tatactaaggctatcgatttgtggagcgtgggatgcatccttgccgaaatgatcaatgga
aagcccttattccctgggagagattaccaccaccaattatctttgatcttacaagtcctc
ggtacccctactatggacgacttcaacgagattacctcccaacgatcaaaagattacctc
cgagcgctagagtttacccgtcgtcaagacttttcggccatctgccctaaagcaatgcct
gcagctgtcgatcttttaaaacgaaccctcactttttcaccatccaagaggatcacagtc
gaagaagcgttgacgcacccttatgtcgaggcttatcatgatccccaagacgaacctaat
gccgaacccctcaagcctggattctttgactttgaattccaccaggagaaattgagtaga
gatcaatggaagcgaatgatttacgatgaggtgcaagatcctgtaccaaccatcctctct
caatggacggcaaaccattaa

DBGET integrated database retrieval system