KEGG   Cryptococcus gattii: CGB_E0540CHelp
Entry
CGB_E0540C        CDS       T02232                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cgi  Cryptococcus gattii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cgi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cgi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(139402..139510,139586..139722,139814..139955,140024..140073,140137..140259))
Genome map
AA seq 186 aa AA seqDB search
MTFFDSIASKFGYESIPADVANKSFYDLKAKLPGNKGDLDFSTLKGKAVLIVNTASKCGF
TPQYNGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQRGEHVGGVAGTTAIKWNFTKFLIDKEGRCVGRYGSSTKPEKLKDE
IEKLLA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacctttttcgacagcatcgcttccaagttcggttatgaatccatcccggcagacgtt
gccaacaagagcttctatgatttgaaagccaaattgcccgggaacaagggtgacctggac
ttttccactttgaaaggcaaggctgtcttgatcgtcaacactgcttccaaatgtggtttc
actcctcagtacaacggtcttgaagagcttcacaagacttacggggacaagggtcttgtt
gtcctcggtttcccttccaacgaatttggaggacaagagcctggctctgatgatgatatc
gcccaattttgtaccctcaaccatggcgtcactttccctcttatgaagaagtccgaagtg
aacgggaagaacatgaacgaggtctttgcctggttgaagtctcagaggggagagcatgtt
ggcggtgttgccgggaccactgctatcaagtggaactttaccaaattccttatcgacaag
gagggcagatgtgttggccgatatggctcttccactaagccagagaagctcaaggacgaa
atcgagaagcttctcgcgtaa

DBGET integrated database retrieval system