KEGG   Cryptococcus gattii: CGB_E0680CHelp
Entry
CGB_E0680C        CDS       T02232                                 

Definition
mannitol-1-phosphate dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cgi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cgi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cgi00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(173686..173752,173808..174459,174514..174645,174704..174938))
Genome map
AA seq 361 aa AA seqDB search
MTTLQGVSIPKTQTVAVVPSVGAAIKIDNQAKVVQADELKPGQCLVKISHTGVCHTDLHA
KQGDWPVPPVNPLIGGHEGVGHIVAIGANTVNSPVKLGDRVGIKWLANSCLTCEPCRRGF
EMNCDHAELSGYTINGTFGEYVVSFVNHVTPIPPSLDSAGAASILCAGVTSYKALKVSNT
KVGDWVALPGAGGGLGHLAVQYAKAMGLKVVAIDTGAAKEKLVKSLGADAWVDFKTTKDL
VADVKAATGGEGPAAAVVTASHKAGYTQAIDYLKPSGTLVAVGLPNAEMGANVFWTVFKS
IRIQGSYVGNRQDAIEALQLVEDGKVKVIFEQKPLADLKTVYEGLEEGKIAGRVVLQVAN
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcttcaaggtgtttctatcccaaagacccagactgttgccgtcgtcccctcc
gtcggcgcagccatcaaaatcgacaatcaggccaaagtcgttcaagctgacgagctcaag
ccgggacaatgtctagtcaagatcagccacaccggtgtctgtcacacagatttgcacgcc
aagcagggtgactggcctgttcctccagtgaaccctttaatcggtggtcacgaaggtgtc
ggtcacattgttgccatcggcgccaacactgtcaactcccccgtcaagctcggtgaccga
gtcggtataaagtggcttgccaattcttgtctcacttgtgagccttgccgacgaggcttc
gagatgaactgtgaccacgcggagctctctggctacaccatcaatggtaccttcggcgaa
tacgtagtttcttttgtcaaccacgtcactcccatccctccttcccttgactctgctggt
gctgcctctattctttgtgctggtgtcacctcctacaaggctctcaaggtctccaacaca
aaggtcggtgattgggttgcccttcccggtgctggtggtggtcttggtcaccttgctgtc
cagtatgccaaggctatgggtctcaaggtcgtcgccatcgacactggggctgccaaggaa
aagctcgtcaagtctctcggtgccgatgcttgggtggacttcaagaccaccaaagacctc
gttgcggacgtcaaggctgccactgggggtgaaggtccggccgctgctgttgtgactgct
tcccataaggctggctatactcaggctatcgactacctcaagccttccggtactttggtc
gctgtcggtctccccaatgccgagatgggtgccaacgtcttctggactgtctttaagagc
atccgaattcaaggttcttacgttggtaataggcaggacgccatcgaagccctccagctt
gttgaggatggaaaggtcaaggtcatttttgagcagaagcctcttgctgaccttaagacc
gtctatgagggtcttgaagaaggcaagattgccggacgagtcgtcctccaggtcgccaac
gagtaa

DBGET integrated database retrieval system