KEGG   Cryptococcus gattii: CGB_E2120WHelp
Entry
CGB_E2120W        CDS       T02232                                 

Definition
ubiquitin thiolesterase 9
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_E2120W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_E2120W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:join(419812..420978,421028..421188,421239..421433,421492..422075,422119..422210)
Genome map
AA seq 732 aa AA seqDB search
MSAFRKFVGNKNAGISALEGDQDPADATLLSRTNANEERLWGIENFSNSCFCNSVLQALY
ACSTFRDFVEAYPDILPPRRPIGPVQVEKRYPSVDWDGPVPGWDPAIRLNKEHRAFIALQ
EANTPMSPAGGKEKRNWMGRKMSSAQSAPTLATLQANQPEQLPSLPNPFPDFDDPLLVRM
PASDNDPPLTLFQTLQTLFYYFSHSPPHMPIKGKGQTKDSEGALIEYTEEEKVDDSGVEV
EKTSSSPQGQPAQPGAASSQQTQSQGQNAQPSGPSKLASLPPPSTFRETGAWRAGQLGWG
VVQPNDVMDAVKRSAPSFNNDDQHDAHEFFSVVVNTLAKEVEAVNEKLRAEGKEVAQMTA
PWAKTFIEALFQGIITSETKCLSCETVSRTSAREEEFIDLSVDIEQHCSITSCLRQFSSD
EMMSGREKFSCESCSGHQEAKRSIRIKRLPPILAIHLKRFAHNENYRAIKLFYRVNHPTT
LIPPNTTDNCENPDQIYDLVAIMVHIGNGPVQGHYVTVKRTPSGRWVMCDDDNIEAIEEN
QLEYWLGNRTQGQGYVLFYQARGITAEQLGLKVEKRKPNGVFEPVGEGVRYVDGYGQAPA
MAPIASAIRNNIRTVNGVMEEEEEEFATSPGSISASVPGLRPLPLAPPIMSPTATSNGVG
HRVDRQFGFNTPANGVAHESTARPPLKKEPSDRKWYNRMSVSAKTRQLMAPTMEVLPHLP
RGLLPLRHPFLL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctttccgcaagttcgtcggtaacaaaaacgcgggcatatctgccctagagggt
gatcaagatccagccgatgcaaccttgctatcacgcacaaatgccaacgaggagcgtcta
tgggggatagaaaacttctccaactcttgcttctgcaactcagtcttgcaagcactatat
gcgtgttccacgtttcgcgattttgtggaagcttatcccgatatcttgccgccgcggcga
ccgatcggacctgtgcaggtggaaaaaaggtatcccagcgtcgactgggatggtccagtt
ccaggctgggacccagccattaggcttaacaaggaacacagggctttcattgctctgcaa
gaggcgaatactcctatgagcccggcaggcgggaaggaaaaaaggaattggatgggtcga
aaaatgtcctccgcacaatcagctccgacattggcgacccttcaagccaaccagcccgaa
caacttcctagtttaccaaaccctttccccgattttgacgatcctttgcttgtcaggatg
cctgcatcggacaatgacccacccctcacattgttccagactctccagacgcttttctac
tatttctcgcattctccacctcacatgcccatcaaaggtaaaggtcagacaaaagactct
gaaggtgctctcattgagtataccgaagaggaaaaagtggatgattcgggtgtcgaggtt
gagaagacttcttcatcgccccaaggtcagcccgctcagccaggtgcagcatcatcgcag
caaactcagagtcaaggccagaacgctcagccttcaggtccatccaaacttgcctccctt
ccaccaccctctaccttccgtgaaacaggtgcttggcgagcaggtcagctcggttggggt
gtagttcagcctaacgacgttatggatgctgtcaagcgctctgcgccatctttcaacaac
gacgatcaacatgatgcacacgaattttttagtgttgtagtcaacactctcgccaaagaa
gtcgaggccgtgaatgaaaaattgagagcggaagggaaagaagtggcgcagatgactgcg
ccctgggcaaagacatttattgaagcattatttcaaggtatcattaccagcgagacaaag
tgtctgagctgcgaaacggtgagtcgcacatctgctcgagaagaagaattcattgatttg
tctgtggatattgagcagcattgctctattacttcctgcctccgccaattttcatcagac
gaaatgatgtctggaagggaaaaattctcttgcgagtcctgttctggtcatcaagaggcg
aaaagaagcattaggatcaaacggctcccacctatcttagctatccatctgaaaagattt
gcccacaatgagaattatagagctatcaagttgttttaccgggtaaatcatccaaccact
ctgatcccacccaacacgacagataattgtgaaaaccccgaccaaatttacgaccttgta
gcgattatggtgcacatcggaaacggtcctgtccaaggccattatgtaacggtcaagcga
acgccttctggtcgttgggtcatgtgtgatgacgacaatatcgaggctattgaggaaaat
cagctggagtactggcttggtaaccgcacccagggccaaggctatgtcttattctatcag
gcgcgaggcatcactgccgaacaattgggtttgaaagtggaaaagcggaagcccaacgga
gtatttgagcccgtaggggagggcgtcagatacgttgatggttatggacaagctcctgcc
atggcgccgatagcctcagcaatccgaaataatatcaggactgtgaacggtgtaatggag
gaagaggaagaggaattcgccaccagtccggggtcgatttcagcctctgtacctggtctg
aggccgttgccattggccccaccaatcatgtcacctaccgctacatccaatggtgttggc
caccgcgttgaccgccaatttggctttaatacccccgcaaatggggtagcacatgagtct
acggcacgaccaccactcaaaaaggaacccagcgacagaaagtggtataatcgcatgtcc
gtgtcagcaaagacaaggcagttaatggcccctacaatggaggtactacctcatcttcct
cgcggccttctaccgctcagacatccatttctgctgtga

DBGET integrated database retrieval system