KEGG   Cryptococcus gattii: CGB_E2440WHelp
Entry
CGB_E2440W        CDS       T02232                                 

Definition
mitogen-activated protein kinase kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cgi  Cryptococcus gattii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CGB_E2440W
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CGB_E2440W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CGB_E2440W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:join(487052..487196,487254..488191,488248..488664,488715..488950,489006..489138)
Genome map
AA seq 622 aa AA seqDB search
MDNTLAPSIGKKPGGARPNPGSRPESGGPARPSGAGDVPRLIIPPGNVPGIHVDQAGEGG
WHQPASLPSLALRPMRPSPTPSSSSRPKLSLTPLTPNALASSSSAPSSASLAPPNRPALL
NTHSARGYGEKSTPSLKLSIPGVSSAGPGYSTENYYPLEQPDDIDALSSELKTPTPGRPP
GGGLNLSLSSLSLASSEDANPTLQARGRDYDDGESSYGYGCVGNGLIGPGGDVISAMTED
IRQALSRNRFETGSDRGGARSRAGSLMSESSQATAGRDRSDSASLYSSASRRESPSASLS
GGSARQSLELPRGAAEELNEQKESPLFDPEELMMIKRLGEGTGGSVDLVQDRATGRIMAK
KVITRTSNPMVHKQLLRELEILNSCASPFIVEHYGSFLADHDSSIGILMEYCEAGSLDSL
LGKMKKKNMRCSEHVLGRVASSVLKGLDYLHQRRIIHRDIKPSNILITRQGAVKLCDFGV
SGELVESLAGTFTGTSFYMAPERIQNKPYSIKADVWSLGMTLHEIAHLRFPFPPEGENQS
VAPIELLSYIVTAPVPVMIDDPSVGRAWSEPIKDFMGQCLIRSGTDRPYPWQLLQHPFIV
ASEAKKVNMAKWVAALCDWPLL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggataatactcttgcgccatctataggcaagaagccaggaggcgccagacccaatcct
ggcagtcgacctgaaagcggtgggcccgccaggccaagcggggccggtgacgtgccaaga
ctcattatacctccaggcaacgtccccggtatacatgttgaccaagcaggcgagggagga
tggcatcagcccgcctctctcccctctcttgctctccgcccaatgcgcccttctccaact
ccttcatcgtcatctcgccctaaactgtccctgaccccgcttacaccaaacgctcttgct
tcgtcaagctctgctccttcttcggcgtccctagctccccccaataggccagcactgctg
aacactcattctgctagaggatatggggagaaaagcacaccaagcttgaaactttctatt
cctggagtcagctccgccggaccaggttactctaccgagaattactatcctcttgagcag
ccggatgatattgacgctctgtcctcggaactgaaaacgccgacgcctggacgtcctcct
ggaggaggcttgaatctaagtctgtcttctctctcacttgcatcatctgaagatgcgaat
cccacactacaagctcgcgggagggactatgatgacggagaatcgtcgtatggttacggg
tgtgtgggtaacggcctgattggacctggaggcgatgtgatcagtgccatgacggaggat
attagacaagcattatctcgaaaccggtttgaaactggatccgacagaggtggggcgagg
agtcgagcaggtagcttgatgagcgagagtagccaggctacagcaggacgtgatagatca
gactcggcgtcattgtatagctcagcttcaaggcgtgaatcaccgtctgctagcctatcg
gggggatctgctaggcaaagtctggaattaccccgaggagcagcagaagagctgaacgag
cagaaggaatcgcccctattcgatcctgaagagttaatgatgatcaagaggcttggtgaa
gggactggtggctcggtggatctggtacaggaccgtgccacaggtcgcatcatggccaag
aaggtcatcacccgaacatcaaaccctatggtgcacaagcagctccttcgtgaactagag
attcttaattcctgcgcttcgccgtttattgtggaacattatggatctttcttggccgac
catgattcctcaataggaattcttatggagtactgcgaagccggcagtctggatagcctt
ctgggaaagatgaagaagaagaatatgaggtgttctgaacatgtcctcggtagagttgct
tcttcagtgctgaaaggtctcgactatctccaccaaaggcggatcatccatcgagatatc
aaaccctccaacatcctcatcactcgacagggagccgtcaaactgtgtgactttggagtc
agtggagagctggtagagtctttggcagggactttcactgggacaagcttctacatggcc
cctgaaagaatacaaaacaagccttattcaatcaaagccgacgtttggtctcttggtatg
accttgcacgagatcgcccatcttcgtttcccctttcctcccgaaggcgaaaatcaatca
gtcgcacctatagagttattatcatacattgtgaccgcgccagtaccggtaatgatcgat
gatccaagtgtgggaagggcgtggagcgagcctatcaaagatttcatgggtcaatgtttg
ataagatcgggaacagatagaccctacccttggcaactactgcaacatcccttcattgtt
gccagtgaagctaagaaggtaaacatggcaaaatgggtagcagccctttgtgactggcct
ctattatag

DBGET integrated database retrieval system