KEGG   Cryptococcus gattii: CGB_E5360CHelp
Entry
CGB_E5360C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cgi03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(1050754..1050849,1050899..1051158,1051211..1051352,1051409..1051537,1051598..1051698,1051761..1051779))
Genome map
AA seq 248 aa AA seqDB search
MSDDDWDVDETVAPAAPAVALPPKVPAKKWADEDAEDNDNDDDWDKSDDEKPQATKTATV
APAKKKGTLKQKLAEKEKLAREAKAKGVDDDDDLMYTMTEQEKRRLAREKEQEADLAVAS
ELMGAVDLGDEGDVLKSVLSARPSTKNDFTELSKNIYTSIIKKHESNPLYSQFVEQLAKD
ISAALTAVQTRKVSSALSVLGNTKQQEERDKASGKKKAASKPKLGGTKVSSKVDTEAYDD
VLGDDDFM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgacgactgggatgttgatgagactgtcgcccctgctgcccctgccgtagca
ctccctcccaaagtccccgctaagaagtgggccgatgaggatgctgaggacaatgacaat
gacgacgattgggacaagtctgatgatgagaaaccacaagcgaccaagacggctaccgtt
gcaccagcaaagaagaaaggtactctcaagcaaaagcttgccgagaaggagaagcttgcc
agggaagctaaggcgaagggagtggacgatgacgatgacttgatgtacactatgactgag
caggagaaacggcggttggctagagagaaggagcaagaagctgacttagctgttgcttct
gaactcatgggcgctgtcgacttgggtgacgagggcgatgtactcaagagcgtgctttcc
gcccgtccatcgaccaaaaatgactttaccgaactctccaagaacatctacacttccatc
attaagaagcacgaatccaatcctctttactctcaatttgtcgagcagcttgccaaggac
attagtgccgcgcttaccgctgttcagactaggaaggtgtcttcagctttgagtgtattg
ggtaacaccaagcaacaagaggagagagataaggccagcggaaagaagaaagctgcgtct
aagcccaagctaggcggtaccaaggtgtcgtccaaggttgacactgaggcctacgacgat
gttcttggagacgacgatttcatgtaa

DBGET integrated database retrieval system