KEGG   Cryptococcus gattii: CGB_E6060CHelp
Entry
CGB_E6060C        CDS       T02232                                 

Definition
sphingosine N-acyltransferase
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cgi  Cryptococcus gattii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CGB_E6060C
Enzymes [BR:cgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CGB_E6060C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(1155052..1155340,1155405..1155478,1155550..1155609,1155666..1155710,1155776..1155939,1156000..1156027,1156077..1156123,1156175..1156263,1156327..1156531,1156610..1156761,1156860..1156921))
Genome map
AA seq 404 aa AA seqDB search
MCQRHKHLHRRRASSVTVALDQIPLNHSQQSPSPEPEVRPLPGRRRKTERDRYGSKGLWS
DIKTGRWLLAPASSFKLSLIAPSLYLIHHLLTTYGIINRSQVPNVFEYFILPSNKLKDGR
YGKSWWDFAFLAHYVIFWTFVRQFMTVRALRPMAKALGIKGQKIVRFTEQGYAVFYFGLL
GACGLYVMRDLPIWWFKTEHFWLEYPHRKMTFQLKTYYLLQAAYWLQQTIIMIAKIEKPR
KDYNELVAHHIVTLWLIGWSYTFYLTYIGVAVFITMDASDLFLGLAKCVNYVSEFYSVPL
FAWFTIVWTYMRHYLNIVILYSVWAQFDLIPLPDRTTFDPLNDQWIDWWMKWQIFTPILL
LQVLNLIWYYLILRILVRALFLNDRRDERSDNEDEVEGDEVKEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaaagacataaacatcttcaccgaagacgggcgtccagtgtaaccgtggctctg
gaccaaatacctcttaaccacagccaacaatctccttcgcctgaacctgaagtgagaccc
ctaccaggtcgtcgacgcaaaacggaacgtgatcggtatggatcgaaaggactttggagc
gatatcaaaactggccgatggctcttggctccagcttcttccttcaaactttcactcatc
gctccatctctttatctgatacaccatctcttgaccacatacggtattatcaaccgctca
caagtgccaaatgtatttgaatactttatcttgccttccaacaaattgaaagatgggagg
tacggaaaatcatggtgggatttcgctttcctggctcactacgtcatcttttggacattc
gtgaggcagtttatgacggttcgagctttacgtccaatggctaaggccttaggaattaaa
ggtcaaaaaattgtacggttcactgagcaggggtatgccgtcttctactttggactcctt
ggagcgtgtggtctttatgtcatgcgcgatcttccgatttggtggtttaagacagagcat
ttctggttagaataccctcaccggaagatgaccttccagctgaagacgtattacctcctc
caagcggcatattggctccagcagacgatcattatgattgccaagattgaaaagccgaga
aaggattacaatgagcttgtggcacatcatattgttactctttggctcattggatggagc
tacactttctatctaacctatatcggcgtggccgttttcatcaccatggacgcgtcggat
ctattccttggccttgccaaatgcgtcaactacgtttcagaattctattctgtaccattg
ttcgcgtggttcaccatcgtctggacgtatatgagacactacctgaatattgtcattctc
tactccgtatgggcccaatttgatctcattcccctcccagaccgaacgacattcgatcca
ttaaatgatcaatggatcgactggtggatgaagtggcagatcttcactccgatccttttg
ttacaggtcctcaacttgatctggtattatctcatcttgaggatcctggtgagagcattg
tttttgaatgataggagggatgaaaggtcggataatgaagatgaggttgaaggggatgaa
gtaaaggaagaatga

DBGET integrated database retrieval system