KEGG   Cryptococcus gattii: CGB_E6070CHelp
Entry
CGB_E6070C        CDS       T02232                                 

Definition
ceramide synthase component; Lag1p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cgi  Cryptococcus gattii
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cgi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(1157837..1158131,1158194..1158267,1158325..1158384,1158437..1158481,1158534..1158697,1158769..1158796,1158847..1158893,1158944..1159032,1159091..1159292,1159376..1159515,1159584..1159619,1159712..1159782))
Genome map
AA seq 416 aa AA seqDB search
MPGPAVTPKKPSQRRRSSVTSALNQIPLNHEQASSVQPVEEVKPLTSRPRLKSKGKRDAL
PAIYSSNGFWDDVKTGRWMLIPSSSFKLMLIPPILYLNHCLLVHYGILGPDTPNIFEHLI
FPSNRLPDGRYGKSWWDLAFMANYIIFWSFVRQFMTLKVFRPMAMSLGIKGGKIMRFTEQ
GYAFFYFGILGSLGVYVMHGLPTWWYKTEHFWLEYPHREMTWELKTYYLMQAAYWLQQTI
LLAAKIEKPRKDFKELVAHHIVTLWLVGWSYNIYLTYIGVSVFVTMDVSDIFLALAKCVN
YVSDFWSVPVFAWFIFVWSYFRHYLNIWILWSVWTQFDLIRPSERSGFDPLNDNWLSWWM
KWQIFTPIFLLQLINLFWYFLIWRILVRAVFYRDLKDERSDDEEENEVEEVKEKAE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcccagcagtgacaccgaagaaacccagtcagcggcgaaggtcaagcgttacc
agcgctctcaaccaaatcccactgaatcatgagcaagcatcatctgttcaaccggtcgag
gaggtaaagccactcactagtcgccctcgactaaagagcaagggaaagagggatgctttg
ccagcaatctatagctccaatggtttctgggatgatgtcaagactggcagatggatgttg
atcccatcatcgtcattcaagctcatgctcatccctcctatcctctacctcaatcattgt
cttctcgtgcattatggcattctcggtcctgatacccccaatatatttgaacaccttatc
ttcccttcaaaccgcttgcctgatggaaggtacggcaagtcatggtgggacctggcattc
atggcaaactacattatcttttggagctttgtgaggcagttcatgaccctcaaagtgttc
aggcctatggctatgtctttgggtatcaagggcggaaagatcatgaggttcacagaacag
ggttatgctttcttttacttcggtatccttggttctctcggtgtctatgtcatgcacggt
ttgcccacatggtggtacaagactgagcacttttggctcgagtatcctcaccgagaaatg
acctgggaactcaagacttattaccttatgcaagctgcctactggcttcagcagactatc
cttcttgcagccaaaattgaaaaaccaaggaaagatttcaaggagctcgtcgctcaccac
attgtcaccctctggttggttggatggagttacaacatctatcttacttacattggtgtt
tccgtctttgttactatggatgtttccgacatcttccttgccctggcaaaatgtgttaac
tatgtttctgacttttggtccgtccctgtctttgcatggttcatctttgtctggtcctac
ttccgccactacctcaatatctggattctctggtccgtctggactcaattcgaccttatc
cgtccatccgaacgttccggatttgaccccttgaacgacaattggctcagctggtggatg
aaatggcagatctttacccccatctttttgctccagctgatcaacttgttctggtacttt
ttgatctggaggattttggtgagggctgtattttacagagacttgaaggatgagagatca
gatgacgaggaggaaaacgaggtagaggaagtgaaggagaaggccgagtaa

DBGET integrated database retrieval system