KEGG   Cryptococcus gattii: CGB_E6580CHelp
Entry
CGB_E6580C        CDS       T02232                                 

Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00010  Glycolysis / Gluconeogenesis
cgi00051  Fructose and mannose metabolism
cgi00562  Inositol phosphate metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
cgi01230  Biosynthesis of amino acids
Module
cgi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cgi_M00002  Glycolysis, core module involving three-carbon compounds
cgi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_E6580C
   00051 Fructose and mannose metabolism
    CGB_E6580C
   00562 Inositol phosphate metabolism
    CGB_E6580C
Enzymes [BR:cgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CGB_E6580C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CGB_E6580C
  Exosomal proteins of bladder cancer cells
   CGB_E6580C
  Exosomal proteins of melanoma cells
   CGB_E6580C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 10189673
NCBI-ProteinID: XP_003194505
UniProt: E6R685
Position
E:complement(join(1281262..1281524,1281598..1281757,1281825..1282134,1282192..1282214))
Genome map
AA seq 251 aa AA seqDB search
MPRKFFIGGNFKMNGSLSSIEKIVRSINEAKLDGTNQVVIAPPALYLLKVQSELERPAEV
SAQNAFTESSGAFTGEIAPQQLKDANVHWVILGHSERRSLFGDTDKLVADKTKAAINAGL
SVIACVGESLEEREADKTMAVVERQLEAIASVVQGDAWNQIVIAYEPVWAIGTGKVATVS
QAQEVHAAIRAWLARRASPQVAESTRIIYGGSVNGKNCGELSEAKDIDGFLVGGASLKPE
FIDICKSGKKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaaaattctttatcggcggtaacttcaagatgaacggctccctctcgtccatc
gagaagattgtccgctccatcaacgaagccaaactcgacggcaccaaccaagtcgtcatc
gccccccccgccctctacctcctcaaagtccaatccgaactcgagcgcccagccgaagtc
tccgcccagaacgcattcaccgagtcgtctggtgcttttaccggtgaaatcgcgcctcag
caattgaaggatgcgaatgtccattgggtgattttgggacattcagagaggaggagtttg
tttggcgataccgacaagttggtcgctgacaagaccaaggccgccatcaacgccggtctc
tccgtcattgcctgcgtcggtgaatccctcgaagagcgcgaagccgacaagaccatggcc
gtcgtcgaacgtcagctcgaggcgatcgccagcgttgtccagggtgacgcttggaaccaa
atcgtcattgcctacgaacccgtttgggctatcggcaccggcaaagtcgccaccgtctcc
caagcccaagaagtccacgccgccatccgcgcctggctcgcccgccgcgcttccccccag
gtcgccgagtccacccgtatcatttacggcggttccgtcaatggcaagaactgtggcgag
ttgagcgaggcaaaggatatcgatggattccttgtcggtggagctagtttgaaacccgag
tttatcgatatctgcaagtctggcaagaaggcgtaa

DBGET integrated database retrieval system