KEGG   Cryptococcus gattii: CGB_F1430CHelp
Entry
CGB_F1430C        CDS       T02232                                 

Definition
ubiquitin specific protease
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_F1430C
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_F1430C
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CGB_F1430C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(303873..304006,304068..304329,304386..304735,304787..304870,304919..305012,305067..305314,305369..305602,305655..305817,305872..306099))
Genome map
AA seq 598 aa AA seqDB search
MATPQSSIFDRTDTSMCPHLSALLSAPSASSRNPGSPEVNGNALGFPIGSKGAEIEKRFV
DVVKWGALPQGVKRRKTMSPGCHTCKTPLSRPWACLTCSYIGCMTLVGKGANEKDCMKRH
WKSSGRKCAFAIDPFTGTIFCDACGDTTYPDTFESLYLTTRIRVEESNDHSREPGVVSGK
GRGRGEWKSWNPGNCALSEREVAKTSCRGLRPLLNLSQTCFLSAILQALVHNPLLKAYFL
SDRHNRYVCTNGGKGLLVGKPFLGVENGPGAVGSDRERGCMCCEMDKAFEEFYNEDKSPF
GPITMLYAMWHASTELEGYGQQDAHSFFLAALDQIHAHAKGQLSSCNCIAHQTFAGTLQS
SVICSKCSKTSNTVDPILDIQLDFPPPSAPSSASSSSDSSAFGPSTNGQADQLTLAGMLR
KFCAPERVGEPGGKGYECSGCGGGVGVVATRKLGVKKLAPVLSFQLKRFAHSSATTSVKI
ESHVRFPSTLDMRPYVDSSSSSKSGKDKKGKGLPDSLYIYDLFAVVTHEGKLDNGHYWAD
VRDGEEWWHCDDDKVTPTSLSAVLAQRAYMLFYVKRSIAYAQPMSKLLASGSTAPNGA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccctcaatccagcatatttgacaggactgacacatctatgtgccctcattta
tccgctcttctcagcgcaccaagcgcttcttcgagaaaccctggctcaccagaagtcaat
gggaacgccctagggtttccaattggatccaaaggagctgagattgagaagagattcgtg
gacgttgtcaaatggggagctttaccgcaaggtgttaagcgacggaagaccatgtctcca
gggtgccatacttgcaaaactccactttccaggccatgggcgtgccttacttgttcatat
attggctgtatgacacttgtgggcaaaggagctaatgagaaagattgtatgaagagacat
tggaagagcagcggaaggaaatgtgcttttgcaatcgatccctttactggtaccatattt
tgtgatgcttgcggggacacaacgtatcctgatactttcgaatcactctaccttactact
cggatccgcgttgaagagtcaaatgatcattcacgcgaacctggagtggttagtggcaaa
ggaagggggagaggcgaatggaaatcgtggaatccaggcaattgtgcgctcagtgagaga
gaagtggcgaagacaagctgccgtggtctacgaccccttcttaacttatctcaaacctgt
ttcctttcggccattcttcaagcactcgttcataatccgcttctcaaagcatatttcctt
tcagacagacacaatcgatatgtatgcacgaacggtggcaaaggccttttggtagggaaa
ccgttcctaggtgtagagaacggcccaggtgcagtgggaagcgatagagagaggggatgc
atgtgctgcgaaatggataaggcttttgaagagttctataatgaggacaaatcgcctttt
ggacctattacaatgctttacgccatgtggcacgcgagcacagagctcgagggttatggt
caacaggatgcccattctttctttcttgctgcgctagaccaaatccatgcccatgcaaag
ggtcagctatccagctgtaactgcattgcccatcaaacctttgcgggcactctccaatct
tccgtcatctgctcaaagtgctccaagacatccaacactgtcgatccaatcctcgacatc
cagctcgatttcccacctccttctgctccttcatcggcatcctcatcctccgactcatct
gcttttggcccgtccaccaacgggcaagcggatcaattaacattagcgggcatgctccgc
aaattttgtgctccagaacgtgttggagaacctggtgggaaaggctatgagtgttctgga
tgcgggggtggcgtgggcgttgtggcgacgaggaaattgggagtgaaaaagcttgctcca
gtgttatcattccaactcaagcgttttgcccattcatccgccaccacatccgttaagatt
gaatcccatgtccggtttccatctaccctggatatgcgtccttacgtagactcttcctca
tcttctaagagtggcaaagacaaaaaggggaaaggattaccagactcgctgtacatatac
gatctattcgcagttgtcactcatgaaggcaagctggacaatgggcattattgggcggat
gtgagggacggagaagagtggtggcactgtgacgatgataaggtgactcctacatcactc
tctgctgtattggcgcagagggcgtacatgctgttttacgtcaaacgatccatagcctat
gcccagccgatgtcgaagttgttggccagcggcagcacggcacctaacggtgcttaa

DBGET integrated database retrieval system