KEGG   Cryptococcus gattii: CGB_F1480WHelp
Entry
CGB_F1480W        CDS       T02232                                 

Definition
phosphatidylinositol 3-kinase TOR1
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cgi  Cryptococcus gattii
Brite
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   CGB_F1480W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(320924..320976,321027..321205,321260..321331,321378..321524,321576..322109,322157..322259,322311..322611,322672..322945,323005..323242,323294..323747,323795..324034,324082..324717,324765..325154,325211..325354,325405..326015,326065..326175,326237..326429,326480..326761,326810..327151,327208..327564,327612..327993,328047..328294,328350..328616,328676..328765,328816..329056,329111..329288,329345..329360)
Genome map
AA seq 2360 aa AA seqDB search
MSSQSDVLDNIFQRLSARSEDVRAQAGQDLAEHVVACTQEYPGHDASKGVWAQVFHKTFE
FTRSNNQPERLGAIIAIAQLLQLTRDDTPDRAQQKVLRLYEYLRPLTTCGDSTVMLPASL
VVEDMVRNSPTLHTDTFLGKEVGQALVMIDDSRQEVGRFSGALLLYAFARAAPGVFHQYI
PKVLEKIWIPLRDSRSVVRERASMLLSTCLDTLKTRGDRPSTDTYRKIFEEARLGLLKAS
STESILGSLLAFNSMLQNQQLSMAEYYRSICELTFKYRDSKEVSIRKAVIALIPSMATYD
SDDFEAHYLHRSMAYLLQALNRPADRDISYVALGHMAVHLGSKMKPFIDDIMRIIRDHLR
MRGKKNAPYEAPIFQCLAMLATSVGPMLTRQMHEILDLMFPWGLSEPLCTALQATASHIP
PLLRTIQDRLLEMLSQTLTGQSYRPLGAPAPRGGAQMDLNLLQSTTNAQSADTLKLALRL
LARFDFVGHTLSEFVRDAALPYLEHDSVEVRREAVLATTTLFMTDPICQQTSSNSVEIVN
DVLSKLLTVAITDPNAGIRRTVLDHLEDKFDRHLAQAADIRCLFIALNDEVFGNRERTIS
IIGRLAHHNPAYVMPHLRKSLINIVTELEYSTNARQKEESAKLLCLMVGAAAGLVKSYAP
TILSVLLRTASSLDSSIGVQAECLKCIGELARVAGEELVPSVRAILDLVIEMLNDQSSPA
KRDTALKTLGQIASNTGEVIKPYTDYPQLMGVLFRFLRMEANSSVRQETIKTIGMLGALD
PFKHKTLLGDVDDPVDEGTTSRVNDIVLLNQHNSSVNDEFFQTVVIHSLVNVLHDSTYKD
HYQAVEAIMMIFRTQRLRCVNFLPQIVPAFLNVIRIAHSSRTELYLKQLAQFITIVKLHI
RNYLNDVFDLIHEFWNPNSSLQITIVSLVEAIAKAVEGEFKAYLPKLLQQILRSFDGDLS
AKHLPELKLNTLLQILKAFYVFGESIEDYLHLVLPVIVRSFENPGAPDSLRIAALRTTGQ
LCRKVNFSDHASQIIHPLVRTLGSSSEELRQTAMETLCVLVLQFGPDYAIFIPMVNKALI
ENKISHPGYEALITKLLNRERLPPDLGPVERYASDSATEASAPEPVALKVNQQALKLAWD
CSHLLNTNSRTEWISWIIGLGHEMMRESPSQAIRAARSLALSSVAFTKELFNVAFYSCWQ
ELFESYQEDLWHNLDRAIKKEDVPGDVVNMILGATQFLEHDEKEVAIESRVLGSVAANYQ
ALAVALHYKEQEFFLDPSKEVIEDLIDVNQKLQQSDAAWGTLEWAQTEMGMTTEVEWYEK
LGRWEEALQVWNERDADASTTFSEWEITEGKVTCLHAMGEWEQLSDFVQARWANRTPEEK
KLLSPLAAAASWSLKQWDLMDDYISAMKGDGADRAFFKAILAVHRNQIPAALKQISKARE
RLDPELTTLTGDSYGRAYDTVVRIQMLAELEEIIAYKDHADEPARQEMQRQTWKKRLAGC
QRDVEVWQRILQVRSLVLKPNEDMDTWIEFADLCRTSDRLNLAEKTLTSLVGFQYPSMED
TRGRAPPPIIFAYLRMAWAKNLQIDSREERYETLQHLRDFTDQLTDDVGIGARGPNGRLM
LPDQKLYGSYTKLLAQCHVELGQWQATLRESQGSADPSGILHDYSLATELDPEWYQAWHT
WALANFEVITQLEVSQQGLSPIHFTTYIIPAVEGFLKSISLSPGNSLQDTLRLLTLWFTY
GYSSGVTAAVSQGLPTVNIDVWLEVIPQIIARIQTPRQSIQQLIVQLLHDIGKAHPQALI
YPLTVASKSTVAARRNVAQNITHKMREHSPKIVDQAELVSTELIRAAILWHEMWYDGLEE
ASKHYFGDHDIPGMLGVLEPLHEIVENGPQTLRETSFIQSFGHDLRIAREHLKRYRITQD
GTEIQQAWDVYYSVFQRLGKQLKLLNVIELQYVSPKLMAVRDLDIAVPGTYQSGKPIIGI
KNVIPTFKVIASKQKPRQCSMRGMDGKEYAYCLKGHEDLRQDERVMQLFGLVNTLLNNDH
ESAKRHLSIQRFSVTPLSPSAGLLGWVTHSDTIHVLIKQYRDQRKILVDIEHKLMQQMSD
ESYDSLPLLHKVEIFQYALDNTTGQDLYRILWLKSRNSDIWLERRTTYTRSLGLNSMVGY
ILGLGDRHPSNLLLDQITGKMVHIDFGDCFEVAQQRDKYPEKVPFRLTRMLIHAMEVCGI
TGNFSRSCEVSMEVLRDNRESLMAVLEAFVYDPLIAWRLTATDKRPGGVGEVKDLDDPTA
YGKQRKNKANETEILNDVENTEVKNDKGLQVIERVRRKLTGRDFKPDVVLDVKSQVEKLV
VEATKTENLCVAFLGWCSFW
NT seq 7083 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaatcagacgttcttgataacatttttcagcgtctgtccgccaggtcggaa
gatgtccgcgcccaggctggccaagatcttgcagagcacgtcgtagcttgtacccaagaa
tacccgggacatgatgcttcgaagggtgtatgggcacaggtctttcacaagacattcgag
tttactaggagcaacaaccagcccgagaggttaggtgctattattgccatcgcccaattg
ttacaattaactagggatgacacaccagatcgtgctcaacaaaaggttctacgcctctat
gaatatctccgacctctcacaacatgcggcgattcgactgtcatgcttcccgcatctctt
gtcgttgaagatatggtccgcaattcacccacccttcacactgatactttccttggcaaa
gaagttggacaagcgctggtaatgattgacgactcacgtcaagaagtcggtcgtttcagt
ggtgcccttcttctctatgctttcgcccgcgctgcccctggagtattccatcaatacatc
cccaaggtcttagaaaagatttggatcccacttcgggactctagatctgttgtccgagaa
cgcgcgagcatgctcttatctacttgtcttgatactctcaaaacccgaggagaccgacca
tccaccgacacataccgcaagatctttgaagaggcccgtcttggtctcctcaaagccagc
tctacagagtctattttgggttctctccttgctttcaattctatgcttcaaaatcaacag
ctctcgatggcggagtattaccgctccatctgcgaactaactttcaaataccgtgattcg
aaggaagtgtctattaggaaggctgttatcgctctcataccgtccatggcgacatatgac
agtgacgactttgaggcacactatctgcatagaagtatggcgtatttgctgcaagctttg
aacagaccggcggacagagacatttcatatgtggcgttgggtcatatggccgtacatctt
ggatccaaaatgaaaccttttattgacgacattatgcgaatcattcgtgaccatctacgc
atgcgaggcaaaaagaatgccccatacgaagcccccatcttccaatgtctcgctatgctt
gctacctctgttggccctatgcttacccgccagatgcacgaaattctcgacctcatgttc
ccctggggcctttccgaacccttatgtacagctcttcaagccaccgcctcgcatatccct
cctctattgaggactatccaagatagattgttggagatgctttcgcagactttgaccggt
caaagctatagaccgctaggtgcgcctgccccacgaggtggagcgcagatggatcttaat
cttttgcaatctacaaccaatgcccagtcagcagacaccctcaaacttgcccttcgtctt
cttgcgcgctttgactttgtcggccatacccttagcgagtttgttcgcgacgctgccctt
ccgtacctcgaacacgacagcgttgaggtccgacgtgaagctgtgttggcaaccacaacc
ctgttcatgacggacccgatctgtcaacagacaagcagtaattcggtcgagattgtaaat
gatgtgttgagtaaattgttaactgtggccattaccgatcctaacgctggtatccgccgg
acggtactcgatcacctcgaagacaagtttgatcgccatctcgcccaggctgcggatatc
cgatgtctctttatcgctctcaacgatgaagtctttggtaatcgcgagagaaccatctcg
atcattgggagactggcacaccacaacccggcgtatgtgatgcctcatttgaggaaaagc
ttgatcaatattgtcaccgagttggagtattctaccaatgcgcgacaaaaggaagagagt
gccaagctgctctgccttatggtcggcgctgccgcaggtctcgtcaagtcttacgcccca
accatcctgtcggtccttctgcgcaccgcttccagcctcgactcttctatcggtgtccaa
gctgaatgtctcaaatgtattggcgagcttgccagagttgcaggagaagaactcgtcccc
tccgtccgagccattctcgacctcgtcatcgaaatgctcaacgaccagtcttcccccgcc
aagagagatactgccctcaagactttgggacaaattgcgagtaacacaggagaggttatc
aaaccttatacagattaccctcagttgatgggggtgctgtttaggtttttgagaatggag
gcgaattcgagcgtcaggcaggagaccatcaagacaattggtatgctgggtgccttggat
ccattcaaacacaagactttgttgggtgatgtggacgaccctgtcgacgaaggaacaacc
tcgcgggtcaatgacattgtgttgctcaaccaacacaactcgtcagtcaatgacgagttc
ttccagactgttgtcattcattccttagtcaatgtcttacatgactctacttacaaagat
cactatcaagccgtggaggccattatgatgatttttaggactcaacggttgagatgtgta
aacttcctccctcagatcgtccctgcattcctcaacgtcattcgtattgcacactcctct
cgtaccgagctttacctcaaacaacttgcgcagtttattacaatcgtcaaattacatatc
cgcaattatctcaatgatgtctttgatctgatccacgagttctggaaccccaactctagt
cttcagatcaccattgtctccctcgttgaagccatcgccaaggctgtggaaggagaattt
aaagcttacttacccaagctcttgcagcagattttgagatcatttgacggagatttgtca
gccaagcacctcccggagttgaaactaaacactttacttcagatcctgaaagcgttctac
gtctttggcgaatctattgaagactacctccaccttgtcttaccagtcattgttcgatct
tttgagaacccgggcgcccctgactctcttcgcattgctgctttgcgtaccactggacag
ctttgtcgcaaagtgaacttttcggaccatgcgagtcagatcatccacccattagtaaga
actttgggtagtagctcagaagagttgagacagactgcaatggaaacactttgtgttttg
gtgttgcagttcggcccagattatgctatcttcatccctatggtaaacaaagctttgata
gagaacaaaatatcacatcctggttacgaagcccttataaccaagttgctcaaccgcgag
cgccttcctccagaccttggccctgtcgaacgatacgccagcgattctgccaccgaagcc
tctgcaccagagcctgttgctctgaaggtcaatcaacaagctcttaagctggcctgggac
tgttcccacttgcttaacaccaatagcaggaccgaatggatctcatggatcattggcttg
ggccatgagatgatgagagaaagccctagtcaagccataagagctgcgaggagtttggcc
ttgagtagtgtggccttcaccaaggaactgtttaatgttgctttctattcatgctggcag
gagctgtttgagagctatcaggaggacttatggcacaaccttgaccgagccatcaagaaa
gaggatgtccctggcgatgttgtcaacatgattctcggtgccactcagttcttggaacac
gatgaaaaggaggtagctattgaaagccgtgttttgggcagcgtggctgccaattatcaa
gctctcgcggtcgctctgcactacaaagaacaggaattcttccttgatcctagcaaggaa
gttatcgaagatctcattgacgttaaccagaaactccagcaaagcgatgccgcctggggt
acccttgaatgggctcagacagaaatgggaatgactactgaggtcgagtggtacgaaaag
ctgggaagatgggaggaagcattacaagtatggaacgagcgagatgccgatgcttcgact
accttctcagagtgggagattaccgaaggcaaggtcacttgtctgcatgctatgggcgaa
tgggagcaactctcagactttgttcaggctcgatgggctaacagaacgccagaggagaag
aagttgctttcaccgttggcggcagcggccagttggtcgctgaagcaatgggatttgatg
gacgactatatctctgccatgaagggagatggggcggatcgcgcgttcttcaaggctatc
ttagccgtgcacaggaatcaaattcctgctgctttgaagcaaatctccaaggcaagggaa
aggttggatccagagttgactaccttgactggtgatagctacggccgagcctatgacact
gtcgtgaggattcaaatgcttgctgaacttgaggaaatcattgcctacaaggaccacgcc
gatgagcctgcccgacaggagatgcaacgacagacctggaagaagcgtctggccggatgt
cagcgtgatgtcgaagtttggcagcgcattctccaggtcaggtcccttgtactcaagcct
aatgaggatatggacacttggattgagtttgcggacctctgtcgaacatctgacaggctg
aacttggccgagaagacgctgacatctcttgttggcttccaatacccatcaatggaagac
actcgaggacgagcaccaccgcccattatcttcgcttacctccgtatggcttgggccaag
aaccttcaaatcgactctcgtgaagaacgttacgagactcttcaacacctgcgcgacttt
accgatcagcttactgacgatgttggtatcggagcgaggggtcctaatggcagactcatg
ttacctgaccagaagttgtatggatcttataccaagttgctggcgcagtgccatgttgag
ttaggtcaatggcaagctactttaagggaaagccaaggatcagccgacccctcgggcatt
ctccacgactattctctcgccacagaacttgaccccgagtggtaccaggcatggcacact
tgggcactggccaatttcgaggtcattacccagcttgaagtgtcacagcaaggtctctca
cctattcactttacgacttatatcatccctgctgttgaaggcttccttaagtccatctcg
ctttctcctggcaactcgttgcaagataccttgaggttgttgactctctggtttacatat
ggatactctagcggggtgactgcggctgttagccaaggtcttcccactgtcaacattgat
gtctggcttgaagtcattcctcagatcattgcccgtattcagacgccccgccagtctata
cagcagctcattgtacagctcctgcacgatattggcaaagcccatcctcaagctcttatt
taccctcttactgtcgcctccaaatctacggtcgctgcccgacgcaatgtcgctcaaaat
atcacccataaaatgcgagagcactctcccaagattgttgaccaggccgagcttgtcagc
actgagcttattcgagcggctatcttatggcatgaaatgtggtatgatggcttggaagaa
gcatcgaagcactactttggtgatcatgatatacctggcatgttgggggttcttgagcct
ttgcatgagattgtcgaaaatggaccgcaaaccctacgtgagacgtcctttatccagtcg
ttcggccatgatctgcgtatcgctcgggagcatctcaagcgttaccgtataactcaggat
ggtaccgaaatccaacaagcatgggatgtctactactccgtcttccagcgtcttggcaaa
cagctcaagctcctcaacgtgattgagctgcaatatgtctcgccaaagctaatggctgtt
cgagacttggatattgctgttccaggtacctaccagagtggcaagcctatcatcggtatt
aaaaatgtcatcccaaccttcaaggttattgcctccaagcaaaagccaagacagtgcagc
atgcgcggtatggatggtaaggagtatgcatattgtctcaagggccacgaggacttgcga
caagacgaacgtgtcatgcaactcttcggtttggtcaacactcttcttaataatgaccac
gaatccgccaagcgacatctcagcatccagcgattttctgtaactcctctttcccctagt
gccggtttgctcggttgggttacccacagtgacaccattcacgttctcatcaaacaatac
cgagaccaaaggaaaatcttggtggatattgagcataaacttatgcaacagatgtctgat
gagagctacgactctctaccgctcttgcacaaggtcgagatcttccagtatgcgctggat
aacacaactggtcaagatttgtaccgcattttgtggctcaagtcacgtaactcagatatc
tggcttgagagaagaacgacttataccagaagtcttggcctcaactccatggtcggttat
atccttgggttgggtgatagacatccttcaaacctgttgctcgaccagattacgggtaaa
atggtccacattgactttggtgattgcttcgaagttgctcaacagagagacaagtaccct
gagaaagtaccgttccgacttacccgaatgctcattcatgccatggaggtctgcggtatc
actggtaatttctcgcgcagttgtgaagtgtctatggaagtcctccgtgacaacagagaa
tcactcatggccgtgcttgaagcctttgtgtacgaccccctcattgcttggcgtcttaca
gcgacggacaaacgacctggtggtgttggcgaagtcaaagatctggatgatccgacggcg
tacggaaagcagaggaagaacaaggcgaatgaaacggagattctgaatgatgtagaaaat
accgaggtgaaaaacgacaagggtctacaggtcatcgaacgagtacgacgaaagttgacc
ggtcgagacttcaagcccgacgttgtactggacgttaagtcccaggtggagaagttggtg
gttgaggcgacaaagacagagaacttgtgtgtggcgtttttaggatggtgttccttctgg
taa

DBGET integrated database retrieval system