KEGG   Cryptococcus gattii: CGB_F1600CHelp
Entry
CGB_F1600C        CDS       T02232                                 

Definition
beta-hexosaminidase precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cgi  Cryptococcus gattii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_F1600C
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CGB_F1600C
   00603 Glycosphingolipid biosynthesis - globo series
    CGB_F1600C
   00604 Glycosphingolipid biosynthesis - ganglio series
    CGB_F1600C
   00511 Other glycan degradation
    CGB_F1600C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CGB_F1600C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(352052..352074,352129..352233,352307..352403,352458..352483,352543..352595,352660..352745,352805..352939,353005..353139,353191..353445,353504..353680,353732..354400))
Genome map
AA seq 586 aa AA seqDB search
MLFNGLLEAVFSSLPFLAPSSRLSAKPDINLVPLPARYTVGDGSTPLCLSTDFSIQSASS
SSAIFPSDLQEAIASTRHRLRNTQTTYLSTTEGLEFFTDSSGAIRSCAYYLDTLYIDLTV
YNGTDIHSETIAPVEERAELEAYKLDLPLKGKAIITSRGALGAFRGLTTFEGLFYSLETE
VQGSKRVHAPFAPYHIEDKPSFGWRAVLLDSSRHYFSVPAILKVLDTMAMVKLNVFHWHI
TDSNSWPLDLDSYPELAVKGAYSRSERYSQKEVQMIIDYAAHRGIDMLLEIDTPGHTASI
APSHPSFVACFESTPFKHFAHQPPAGQLRFADDEVTEWTAQLLQEVSSLSKGRYFSTGGD
EINVNCMLEDLPTTSALKARGWTLDDALDHFTKKTHAPLRHAGKTPVVWQEMVLNHGKMS
SLTNDTIVDIWVNSADARKVLDQGYRIVHASADYFYLDCGQGGWIGEEGGGNSWCDPMKS
WARMYSFDPFKDVKDEERHLILGGQTSLWTEQTDEMNLEPTLWPRAAALAEVFWSGPGPD
GRPRSANKALSRMHDIRYRMVERGVRAAPLQPHWCALRPGACVLGA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcaatggccttctcgaagctgtcttctcgtcactaccgttcctcgctccttcg
tctcgtctttcggccaaacccgatatcaatctcgttcctctaccagcgcgttacactgtc
ggtgatgggtcgacccctctttgtctttctaccgattttagtatacaatcagcatcctca
tcttcagccattttcccttctgaccttcaagaggctatcgcatcaacacgtcaccgcttg
aggaatacccagacaacatatctttcgactaccgaaggattggaattcttcaccgacagc
tctggtgctatccggtcttgcgcatactatcttgacaccttgtacattgacctcacagtc
tataatggtacagatatccactcggaaaccattgcaccggtcgaagaacgcgccgagctg
gaggcctacaagcttgatctccctctcaaggggaaagcaatcatcacctctcgaggagct
ttaggcgctttcagaggtctcaccactttcgaaggtcttttctacagtctggagacggag
gtccagggatcaaagagagtgcatgctccatttgctccttatcacattgaagacaagcca
agttttggctggcgtgcagtgttgttggatagctcaagacattacttttcggttccagcc
atcctgaaagtactagatacaatggcaatggttaagctcaatgttttccactggcacatc
accgattccaattcatggcctttagaccttgatagctatccagaattggcagtcaaagga
gcatattctcgatctgagaggtacagtcagaaagaagtacagatgattattgactatgca
gctcatagaggcattgacatgcttctggagattgacacacccggtcacactgcctctatt
gcaccctctcacccatccttcgtggcatgcttcgagtcgacgccattcaaacatttcgct
caccagcctccggccggtcagctgcgatttgcggacgacgaagtgacagaatggacggct
cagcttctgcaggaggtcagcagtctgtccaagggaagatatttcagtacgggaggggat
gagatcaacgtgaactgcatgttggaagatttacccaccacatctgcgctcaaagccaga
ggatggacgctggatgacgcgttggatcattttactaaaaagacacatgcccccttgaga
catgccggaaaaactccagtggtctggcaagagatggtgctcaatcacggcaagatgtca
tcacttaccaatgataccattgttgatatatgggtgaactctgcggatgctcgcaaggtt
ttggaccaagggtaccgcatagtccacgcttcggcagactacttttacttggactgtgga
caaggtggatggataggggaagagggaggtggtaacagctggtgtgatcccatgaagtct
tgggcaagaatgtattcctttgaccctttcaaagatgtcaaagacgaagagaggcacttg
attctgggtggtcaaacatcgctctggacagagcagaccgatgagatgaatctggagcct
actctctggcccagagcagcagctttggctgaagtcttttggtcaggcccaggaccagac
ggccgacctcgaagcgcaaacaaggcattatccagaatgcacgatatccgctatcgaatg
gtagaaagaggcgtgagagctgcacctctgcagcctcattggtgtgctcttcgtcccggt
gcgtgtgttctaggtgcttga

DBGET integrated database retrieval system