KEGG   Cryptococcus gattii: CGB_F1600CHelp
Entry
CGB_F1600C        CDS       T02232                                 

Definition
beta-hexosaminidase precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cgi  Cryptococcus gattii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cgi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cgi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cgi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(352052..352074,352129..352233,352307..352403,352458..352483,352543..352595,352660..352745,352805..352939,353005..353139,353191..353445,353504..353680,353732..354400))
Genome map
AA seq 586 aa AA seqDB search
MLFNGLLEAVFSSLPFLAPSSRLSAKPDINLVPLPARYTVGDGSTPLCLSTDFSIQSASS
SSAIFPSDLQEAIASTRHRLRNTQTTYLSTTEGLEFFTDSSGAIRSCAYYLDTLYIDLTV
YNGTDIHSETIAPVEERAELEAYKLDLPLKGKAIITSRGALGAFRGLTTFEGLFYSLETE
VQGSKRVHAPFAPYHIEDKPSFGWRAVLLDSSRHYFSVPAILKVLDTMAMVKLNVFHWHI
TDSNSWPLDLDSYPELAVKGAYSRSERYSQKEVQMIIDYAAHRGIDMLLEIDTPGHTASI
APSHPSFVACFESTPFKHFAHQPPAGQLRFADDEVTEWTAQLLQEVSSLSKGRYFSTGGD
EINVNCMLEDLPTTSALKARGWTLDDALDHFTKKTHAPLRHAGKTPVVWQEMVLNHGKMS
SLTNDTIVDIWVNSADARKVLDQGYRIVHASADYFYLDCGQGGWIGEEGGGNSWCDPMKS
WARMYSFDPFKDVKDEERHLILGGQTSLWTEQTDEMNLEPTLWPRAAALAEVFWSGPGPD
GRPRSANKALSRMHDIRYRMVERGVRAAPLQPHWCALRPGACVLGA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcaatggccttctcgaagctgtcttctcgtcactaccgttcctcgctccttcg
tctcgtctttcggccaaacccgatatcaatctcgttcctctaccagcgcgttacactgtc
ggtgatgggtcgacccctctttgtctttctaccgattttagtatacaatcagcatcctca
tcttcagccattttcccttctgaccttcaagaggctatcgcatcaacacgtcaccgcttg
aggaatacccagacaacatatctttcgactaccgaaggattggaattcttcaccgacagc
tctggtgctatccggtcttgcgcatactatcttgacaccttgtacattgacctcacagtc
tataatggtacagatatccactcggaaaccattgcaccggtcgaagaacgcgccgagctg
gaggcctacaagcttgatctccctctcaaggggaaagcaatcatcacctctcgaggagct
ttaggcgctttcagaggtctcaccactttcgaaggtcttttctacagtctggagacggag
gtccagggatcaaagagagtgcatgctccatttgctccttatcacattgaagacaagcca
agttttggctggcgtgcagtgttgttggatagctcaagacattacttttcggttccagcc
atcctgaaagtactagatacaatggcaatggttaagctcaatgttttccactggcacatc
accgattccaattcatggcctttagaccttgatagctatccagaattggcagtcaaagga
gcatattctcgatctgagaggtacagtcagaaagaagtacagatgattattgactatgca
gctcatagaggcattgacatgcttctggagattgacacacccggtcacactgcctctatt
gcaccctctcacccatccttcgtggcatgcttcgagtcgacgccattcaaacatttcgct
caccagcctccggccggtcagctgcgatttgcggacgacgaagtgacagaatggacggct
cagcttctgcaggaggtcagcagtctgtccaagggaagatatttcagtacgggaggggat
gagatcaacgtgaactgcatgttggaagatttacccaccacatctgcgctcaaagccaga
ggatggacgctggatgacgcgttggatcattttactaaaaagacacatgcccccttgaga
catgccggaaaaactccagtggtctggcaagagatggtgctcaatcacggcaagatgtca
tcacttaccaatgataccattgttgatatatgggtgaactctgcggatgctcgcaaggtt
ttggaccaagggtaccgcatagtccacgcttcggcagactacttttacttggactgtgga
caaggtggatggataggggaagagggaggtggtaacagctggtgtgatcccatgaagtct
tgggcaagaatgtattcctttgaccctttcaaagatgtcaaagacgaagagaggcacttg
attctgggtggtcaaacatcgctctggacagagcagaccgatgagatgaatctggagcct
actctctggcccagagcagcagctttggctgaagtcttttggtcaggcccaggaccagac
ggccgacctcgaagcgcaaacaaggcattatccagaatgcacgatatccgctatcgaatg
gtagaaagaggcgtgagagctgcacctctgcagcctcattggtgtgctcttcgtcccggt
gcgtgtgttctaggtgcttga

DBGET integrated database retrieval system