KEGG   Cryptococcus gattii: CGB_F2290WHelp
Entry
CGB_F2290W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cgi  Cryptococcus gattii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CGB_F2290W
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CGB_F2290W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CGB_F2290W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(466960..467490,467612..467861,468136..468533,468587..468853,468901..468996,469038..469196,469236..469301,469354..469687,469727..469845,469889..469933)
Genome map
AA seq 754 aa AA seqDB search
MGSLENDHVLDNLWTTEDESFEVQMPDFHFDWGLEKGKTAEQGMKPPTASLHSLSIKEIT
PPLPSGSSSASTPPHSTYSARSSISSVQVLPKMGASDASVSPHIPTPPGSIVNPGHQSLS
AQNTSKSGGSSSGESSGERGKIYGGRKFQRVVSAPISPKNGTETDGVEFQVSGDVCSLSS
VSLVDASTVPGRTNLITPALPERTLPTARSTVRRLGGLSKFGGPARRVILPQGSEDAQVQ
ENVENGNVNELQGRHSSALIRASRTPAALSPEGEDKDKLFRPFGKLDEKLRPVAGPSKAS
GLRYMHSLPEAGPEARDMQVTDPRSLDVGKPASPPYRSLCAARPPPIAESRRNAPTVSTA
TVVNASASHPMMPSEISLPPPTQSAPQGKTLFHVNAVPYERLQRLGKGGSSTVYSVLYPG
PKKKIIYALKVVQLDRADSETYQSYTNEIELLKRLRGHDRVIQLIDHQITFNQHNRPHRL
LMVMECGEIDFAALLDEQRGKAINMNFVGLYWEQMLEAVQAVHRENVVHTDLKPANFVLV
KGRLKIIDFGIAKAVANDTVNIQRDQQIGTVNYMSPEAIQRMNNQKVLKLSYPSDVWSLG
CILYQMIYGSPPFQHISGGPLAKMGVIADPNHVVTYPEVAVPKTAVGFSLDGHPTDPASL
SVPVSPSAIDSMKRCLAYRKEHRLTIPELLQHEFLKPRIRAPAVPPGSTPITQYQMERLV
NFILSENGLPELSEGNHTAEDLFSQLEAQNALSK
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgggctcactcgagaacgatcatgttctggataatctgtggacaacggaggacgagtcg
tttgaagtgcaaatgccagatttccattttgattggggattggagaaagggaaaacggca
gagcaaggaatgaagccgcccactgcctccttacactctctatccatcaaagaaatcacc
ccgcctctacctagcggctcttcttccgcctctacccctcctcattccacttattcggca
aggtcgtcaatatcttctgtacaggtgttacccaaaatgggcgcctccgatgcgtctgta
tcaccacatatacccactcctcccggaagcatcgttaaccctggccatcagtcattatct
gctcaaaacaccagcaagtctggaggaagctccagtggggagtcgagcggtgaacggggc
aagatttatggtggccgcaagttccaacgcgtagtgtctgctccaatatcgcccaaaaat
ggaacagaaacggacggagtagaatttcaagtttcaggggatgtttgctcactatcgtct
gtgtcacttgttgatgcatccacagtgccgggtcgtacaaatctcataacccctgcactc
cctgagcgcactttaccaactgccaggtcgacagtgagacgtttgggcggactctctaaa
tttggcggtccagcaagacgtgttatattaccccagggaagtgaggatgcccaggttcaa
gaaaatgtggaaaatggcaatgtcaatgagctgcaaggaagacacagctctgccctcatc
agggcatcacgtacaccggcggccttatcgccggaaggagaggataaagacaaactgttt
cggccttttggtaaactggatgagaaattgcggcctgtggctggtccctcaaaggcttca
ggtcttaggtatatgcactctttgccagaagcaggaccagaagctcgggacatgcaggtt
accgaccctcgctcgttggatgtcggcaaaccagccagccctccctatcgcagcctttgt
gctgcccgcccaccaccaatcgctgagtcacgcagaaatgccccaacggtatcaactgct
accgttgttaatgcatctgcatctcatcctatgatgccatcagaaatatcgttgcccccg
cctactcaaagtgctccacaaggcaaaactttatttcatgtgaacgcagttccatacgaa
agattgcagcgccttggaaagggcggctcatcaacggtttattctgtcctttacccgggt
cctaagaaaaaaatcatctacgctctcaaggtagtgcaactcgatcgtgcagattccgaa
acatatcaaagctatacaaatgaaatcgagcttttgaagcgtctccgtggacacgatcgt
gttattcagctcatcgatcatcaaataactttcaaccaacataatcgccctcatcgtttg
ctaatggtcatggagtgcggtgaaattgattttgcagcattgctagatgagcagcgaggg
aaggcgatcaatatgaattttgtcggcttatattgggagcaaatgctcgaagctgtccag
gccgtccaccgcgaaaatgttgttcatacagatttgaagccggccaacttcgttcttgta
aaggggcggttgaaaatcattgactttggaattgcaaaagcagtggccaatgacactgtc
aatattcagcgcgatcagcaaattggcaccgtaaactatatgtcacctgaggctattcaa
agaatgaacaatcagaaggtattgaagttatcctatcccagcgatgtttggtcacttggt
tgtatcctttaccaaatgatttatggtagccccccctttcaacatattagtggaggacca
ctggcgaaaatgggtgtaatcgcagatcccaaccacgtcgtcacttatccagaagtggct
gtacccaaaacagcagttggattcagtcttgacggtcatcctacagaccccgccagtcta
tctgtccctgttagcccgtctgccattgattcaatgaagcgatgtttagcgtatcgcaaa
gagcatcgactgacgatacctgaactattgcaacatgagtttttgaaaccaagaataaga
gctccagctgtgcctccaggatctactccaataacacagtatcagatggagcgactggtc
aactttattctgtcggagaatggcctaccagaactgtcagaaggcaatcacacagctgag
gatctattctctcaactggaagctcagaacgcattgtctaaatga

DBGET integrated database retrieval system