KEGG   Cryptococcus gattii: CGB_F2490WHelp
Entry
CGB_F2490W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(554230..554274,554450..554495,554654..554736,554793..554910,554998..555072,555132..555239,555298..555328,555390..555557,555615..555931,555986..556231,556289..556461)
Genome map
AA seq 469 aa AA seqDB search
MGSMEPILGESKRRVCYFFDSDIGNYHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIFRA
KPATKREMSQFHTDEYVDFLYRINPDNAAQFAKEQVKYNVGDDCPIFDGLFEYCSISAGG
SMEGAARLSRDKCDIAVNWAGGLHHAKKAEASGFCYVNDIVLGILELLRYHQRVLYIDID
VHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGEVRDNGIGKGKGYAINVPLRDGISDDN
YKSIFQPVIKRVIEWYQPGAIVLQCGSDSLSGDRLGSFNLSMKGHAACVQFVKSFNLPLL
LLGGGGYTVKSVSRTWAYETGLAAGMELGRDLPNNEYWEYYGPDYELDVRSSNMTDQNTP
EYLQKVKEAVFEVLRDKNAAPSVPLQSVPKMMHDDDDEDEGEDNEDKDVRRPLRLWAREK
QHETSLSDSEDEGTGGRKHRRSYKESTQKKHRSKSPSHQMESSIIADEA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtatggaacccattctgggggagagcaagcgaagagtttgctatttttttgat
tctgacattgggaattatcattatggacctggtcatccgatgaagccgacccgcattagg
atgtgtcactcacttgttatgaactatggcttgtacaagaagatggaaatttttcgggcc
aagcctgccactaaacgtgaaatgtcccagttccatacggatgaatatgtcgacttttta
tatcgaataaatccggacaatgctgctcagtttgcgaaagagcaagtcaaatataacgtc
ggcgatgattgcccaatttttgatgggttattcgaatattgctcaatctcggcaggcggg
tccatggagggtgccgcacggctttctcgcgacaagtgcgacattgctgtcaactgggct
gggggtctacatcacgccaaaaaggcggaagcgagcggattctgttatgtcaatgacatt
gtccttggtatcctcgaattattgaggtatcatcaacgtgttctgtacatcgatatcgac
gtacatcacggagatggcgtggaagaagccttttatacgaccgacagggtcatgacgtgc
agttttcacaagtacggtgaatttttccctggtactggtgaagtaagagataatggaatt
ggcaaaggtaaaggatacgctattaatgtacctcttcgagacgggatcagtgatgacaac
tataagagtatcttccagcccgtaatcaagcgtgtcattgaatggtatcaaccaggagct
atcgtacttcaatgcggttctgattctctttccggagatcgcctgggatcattcaacctt
tcgatgaagggccacgctgcttgtgtgcagtttgtcaaatcgttcaacctgcctttattg
ttgcttggcggaggtggttacacagtcaagtctgtttcaaggacttgggcatatgagact
ggccttgctgcaggcatggagctagggcgtgatctgcctaataatgaatattgggagtat
tacgggccagattacgagcttgatgttcgttcttccaatatgacagatcagaacactccc
gagtaccttcaaaaagtcaaggaagcggtttttgaagttttgcgcgataagaatgctgcc
ccaagtgttcctctacaatcggtacccaaaatgatgcatgatgacgacgatgaagacgaa
ggcgaagacaatgaagataaggacgtccgtcgtccactgcggctttgggccagggaaaag
caacatgaaacatccctctcggattccgaagacgaaggcacaggaggtcgaaaacatcgg
cgcagttacaaagagtccacacagaagaaacatcgttcaaaatccccttcccatcaaatg
gaatcctccatcatcgcggatgaggcgtag

DBGET integrated database retrieval system