KEGG   Cryptococcus gattii: CGB_F3130CHelp
Entry
CGB_F3130C        CDS       T02232                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_F3130C
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_F3130C
Exosome [BR:cgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CGB_F3130C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(599797..600141,600199..600326,600389..600723,600777..601650,601707..601895,601958..602231,602283..602339,602377..602409))
Genome map
AA seq 744 aa AA seqDB search
MPLLLQRCLSFTGHPLGIVIKRSRKEIRKRDSSEPPMKKLAISAPKDEEIWDYNTSFVCL
ACSSAGQEITAQESKLDEMKSGIMTALSSAQQSEIKAWEEEIVPCEHTLTLQQEPVVVPG
NVPSQCSSCDLTSNLWLCLTCGLANCGRQQFGGIGGNGHALKHFHETGHMLGVKLGTITP
EGTADIYCYACDDAKVDPELATHLSTFGIEVMGQTKTEKSMTELQLEHNLKFDFSMVGDD
GKELEPVFGKGLTGLRNLGNSCYMASVLQTLFALPAFRRRYTTPEAYNHFQTCPNPLPAS
CMECQMLKLGDGLLSGRYSHVARLPPPTTHLEEQEAPKFQEGIKPTQFKALIGKGHEEFS
TMRQQDSEEFLQHLLTRLRDEAKRQGRNGATEPTEILKFAMEQRLQCGKCKRVGLQVEGV
DLASLPVEAVEAGVSEDGKKLYEGVELESCLEQLCAEEPVAEYQCANCKEKTTAYKSTKF
KTFPELLVLHMKKFQLVNWLPTKLDIPVSVPDILILDHLIAQGLQPGEEELEVSSSSPSL
PEFNATAMAQLEAMGFPTVRCQKALLATGNSDAETAMGWLFEHMEDPDIDAPIELRGSKA
ASNEPSQEQIGMIADMGFSHNQARKALRESDGNPERAIEWLFSNPDDPGEDAAPAPAGSA
EPLVGGSSSLPAKYRLKAFVSHKGPSVHSGHYVATIRQPQAGIEGEREAEEEWVLYNDEK
VVRAASGGGEEMRGLAYLYVYERV
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctgcttcaacggtgcttgtctttcaccggccatcccttgggtatcgttatc
aagcggtccaggaaggagattcgcaaaagagactcgagcgaaccgccaatgaagaaactc
gccatttccgcacccaaagacgaagaaatatgggattacaacacctcctttgtgtgcttg
gcctgctcgtctgcaggtcaagaaatcacggctcaagaatccaagttggatgaaatgaaa
agcgggataatgactgcgctttcatctgcccagcagtccgagattaaggcttgggaagag
gaaattgttccttgtgagcataccctcaccctgcagcaagagcctgttgttgtccctgga
aatgttccatcacagtgttcctcttgcgatcttacttccaacctgtggttatgtctcacc
tgcggtcttgccaactgtggtcggcaacaattcggcgggattggtggtaatggccacgca
ctgaaacactttcacgagacgggacacatgttgggagtcaagttgggtaccatcaccccg
gaaggaactgctgatatttactgctacgcctgtgacgatgctaaggtcgaccccgaactg
gccacgcacctttcaacgtttggcattgaagtaatgggtcaaaccaaaactgaaaaatcc
atgactgaactccagctcgaacacaatttgaaattcgatttttccatggtcggcgatgac
ggcaaagaactcgaacctgtatttggcaaaggtcttactggtctaagaaacttgggaaac
agctgttacatggcttctgtcctccaaactctcttcgccctccctgctttccgaagaagg
tatactacaccggaagcgtacaatcatttccaaacctgtcccaatcctctccctgcttcc
tgcatggaatgccaaatgctcaagctcggtgatggtttgctttccggaaggtactcccat
gtggcaaggttaccaccacccactacccatcttgaagaacaagaagctcccaagttccaa
gaaggaatcaagccgacacagtttaaagcacttatcggtaaaggccacgaagagttttcg
actatgcgtcagcaagattctgaagagtttttacagcatcttttgactcggttaagagac
gaagcgaagcgtcaaggtagaaacggggctaccgagccgacggagattctcaaatttgca
atggaacagagattgcagtgtggcaagtgcaagcgtgtcggtctccaggtagaaggtgta
gatttggcgagcttgcctgttgaggcagtggaggcgggggtgagtgaagacggcaagaag
ctttacgagggggtcgagcttgaatcatgtttagagcaattgtgtgcagaggaaccagtg
gccgagtatcagtgtgcaaattgcaaggaaaagacgacggcatacaaatcgaccaagttc
aagacattcccagagttgttggtgttgcacatgaaaaagtttcaacttgtgaattggctc
ccaaccaaacttgatattcctgtatctgtccccgacattctcattttggaccacctcatc
gcccaaggactccaaccgggtgaagaagagcttgaagtatcgtcatcgtctccttccctg
ccagagttcaatgccactgccatggcgcagcttgaagctatgggattccccacagtgaga
tgccaaaaagcattattggcgactggcaacagcgacgcagagaccgctatgggatggttg
tttgagcatatggaagatcctgacattgatgcgccgattgagctcagaggttcaaaagcc
gccagcaacgagccttcacaagaacagattggcatgattgccgatatgggattctcacat
aaccaagctcgcaaggcattgcgcgaaagcgacggcaaccccgagcgggctatcgagtgg
ctgtttagtaaccctgatgatccaggagaagacgctgctccagctccagcaggtagtgcc
gaacctttagtcggaggctcctcttcacttcctgccaagtaccgactgaaagcattcgtc
tcgcacaagggcccgtctgtgcattctggccattatgtggctacgatccggcagccgcaa
gcggggatcgagggggagagggaagcagaggaagaatgggtattgtacaatgatgaaaag
gttgtgcgagctgcatctggcggtggggaggagatgcgggggcttgcatatttgtatgta
tatgaacgagtgtag

DBGET integrated database retrieval system