KEGG   Cryptococcus gattii: CGB_F3340WHelp
Entry
CGB_F3340W        CDS       T02232                                 

Definition
(RefSeq) acyl-protein thioesterase-1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGB_F3340W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CGB_F3340W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 FSH1 Lipase_3 Abhydrolase_1 DLH AXE1 Esterase DUF2974
Motif
Other DBs
NCBI-GeneID: 10190176
NCBI-ProteinID: XP_003194746
UniProt: E6R851
Position
F:join(647441..647512,647568..647583,647634..648010,648066..648141,648189..648364)
Genome map
AA seq 238 aa AA seqDB search
MPSSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPIVPVS
LNQGMAMPSWFDIRHLDKLDNPEHDDEQGMLETVKSVDELIQAEVDSGISEDRIVLGGFS
QGGAISLLSALTTKRKLAGVVGLSCWVPLSHKIAQMKSEHAKDIPIFWGHGTNDPVVDYS
FGQRSIDFLVQKCGYRLLPQGTTFARPGIRFESYPGMPHSSCPQEIDDLKSWLTQALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccctcatctttgaaacacttgaagatctcgcccaaggaggcccatactgctactgtc
atattccttcacggtttgggcgatagtggccatggctggcttcctgttgccaagatgctt
tggagctcattcccaaatgtgaaatggatactcccacatgcccctatagtccccgtctcc
ttaaaccagggcatggctatgccttcctggttcgacatccgtcaccttgataaattggat
aacccggaacacgacgatgaacaggggatgctcgaaacggtaaagtctgttgatgaactt
attcaggcagaagtagacagtgggatctctgaagataggatcgttctcggtggcttctcg
cagggcggtgccatcagtcttctcagtgcgctgacaactaagagaaagctggctggagtg
gtggggttgagctgctgggtcccactcagtcacaagatcgcacaaatgaagtctgagcat
gccaaggatattcctatattctggggccacggaacgaatgacccagtggtcgattacagc
tttggacaacgatcgattgatttccttgtccaaaaatgcggctacagacttcttcctcag
ggcactacctttgctcgccctggtatccgttttgaatcctatccaggaatgcctcattct
tcttgtcctcaggagattgatgatctcaagtcttggctaacgcaggcgctcaaataa

DBGET integrated database retrieval system