KEGG   Cryptococcus gattii: CGB_F3610CHelp
Entry
CGB_F3610C        CDS       T02232                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cgi  Cryptococcus gattii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CGB_F3610C
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGB_F3610C
   00640 Propanoate metabolism
    CGB_F3610C
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CGB_F3610C
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CGB_F3610C
Enzymes [BR:cgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CGB_F3610C
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CGB_F3610C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(717674..717785,717837..718036,718092..718198,718251..718442,718497..718979,719032..719217,719268..719358,719416..723935,723990..724381,724429..724694,724748..724830,725094..725175))
Genome map
AA seq 2237 aa AA seqDB search
MSSATPNGSAVNGPSDIYDHSKVAQFIGANSVESAPSGRVTDFVKAHNGHTVITKVLIAN
NGIAAVKEIRSIRKWSYETFGSERQIEFTVMATPEDLRINAEYIRMADRYVEVPGGSNNN
NYANVDFIVDVAERAGVHAVWAGWGHASENPRLPETLAKSKIVFIGPPGSAMRSLGDKIS
STIVAQHAKVPCMAWSGTGISDTVLSPQGFVTVPDKAYDDACVHNWEEGLERAEKIGFPV
MIKASEGGGGKGIRKVEDGEKFKNAFQAVAGEVPGSPIFIMKLAGSARHLEVQLIADQYG
NAISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFEEMEKAAVRLAKLVGYVSAGTVEYLYS
HSDDSFYFLELNPRLQVEHPTTEMVSGCNIPAIQLQVAMGIPLHRIRDIRTLYGMDPHGI
TEIDFYGSKPESVNTQRKPTPKGHVIACRITGENPDAGFKPSSGNLTELNFRSNSNVWGY
FSVSSAGGLHEYADSQFGHIFAYGMERSEARKSMVVALKELSIRGEFRTTVEYLIKLLEK
PEFENNTLTTQWLDGLIAEGMTSERPDPVVAVVCGAVVKAYIAYEASLAKYKSVLDKGQV
PSKDSLQTFFKSEFIYENVRYSFAMAKSSAYSFTLYLNGGRIFVGCRGLSDGGLLISLGG
ASHTVYFREEVGAMVLSVDSKTTLIEDEQDPSQLRSPSPGKLVRYLIDSGDHVNAGDAYA
EIEVMKMIMPVTASESGIAQFMKQPGQTLAAGELLGILTLDDPTKVKFAKPFEGILPTFE
LKDGRYGTKPHQRLREHLEVLYDNLSGYDNSASVLSSLRIVEAALRDADLPYSNAQGVMS
TLSGRIPQKLEEDIRSTLDSCRAKQLEFPSLKLQHIIDVFVEENVMPKERPQVIAAISPL
KTLIDAFAHGLKVHEWQTWADLLNFFADVEEPFADTARTQENVILKLRDDCKDLDQVVNL
VLSHSKIALKTKLVLALLDIIKSESPRASMTPESRVNDALGRLAALDSRPTAKVALKAKE
VMIVGSLPSYEERLGQLERLLSAAVTTSYYGQQGSGHRLPSGDVLKEVTDSRYTVFDVLT
TFFDHDDPWVALAALEVYVRRAYRVYNVLHLDYEAGEKGGEPHIITWRFKLGGHQSEPIT
PRVDSTKDFTRIASMSDLSYVVNTKTEPVRFGLMTSYNDLASLEQGFAKLLSMYPAFSHV
EHIEKFGGDARHPHVMNVALRLFNGEQMSDIELNVRFHALANRYATGISGKGIRRVSFVI
CRKDQYPAYVTLRESAEGSWKEEEAIRDIEPALAYQLELGRLSNFKITPQPSSNRQIHVY
HAVGRENTSDVRFFVRALLRPGRFQGNMQVKEYLISETDRLVGDILDTLEVVSSQHRQAD
CNHIMVNCVYNLNVTFDDIQEALAGFIERHGKRLWRLRVTQAEIRVVIEDEEGNVLPIRS
FIENVSGFVVKYEAYQEIDNDKGKSILKSIGENGQFHLQPVNFPYSTKESLQPRRYQAHV
IGTTYVYDFPDLFRQATDKAWHNLQAFLPNIKIPSDLLTATELVSDERGELQEVTRAPGL
NTCGMVAWVYTLKTPEYPQGRRVVVISNDITYQIGSFGPAEDEFFYKATQYARKHGLPRI
YLSANSGARIGLAEEVMALFDVAWHEAGKPEKGFDYLYLTPANLEKLNDMGSGSVITDEI
EVNGERRHKIVSIIGLKDGLGVECLRGSGLIAGETSRAYDDIFTISMVTARSVGIGAYLV
RLGQRVVQVEGQPIILTGAQAINKVLGKEVYTSNIQLGGPQIMYKNGISHLTAGSDLDGA
LQIINYLMFIPEQRGRAIPILPTGDHWDRAVEWKPTKAAYDPRNFLSGCNEDVDGVQSWK
SGILDNGSFFETMGGWAQTIVTGRGRISGIPVAVIAAETRSIERVDPADPANENSQENRV
SLAGTVWFPDSSRKTATAIEDANREGLPLVIFANFRGFSGGMSDMAQAILKEGAKIVDGL
SSYKHPVIVYLVPNGELRGGAWVVLDPSINPEHMTMFVDNESRGGVLEPEGIVEVKYRKP
KVQATMARLDEEYARLKKEVENPNASPEQKTAATAKLEAREKHLGPAYQSVALEFADLHD
RSGRMKAKADCTPCDWENSRRAIYWSLRRKLSEIRILKKLENANPRLTYPQRKELLQQFV
PAELSSDSEVAAYIEKSGETIESFIQGVRDEWCSDTLVSWAGTNQDGVMSGFKRILEGLS
VEQKAQVLAELGVQSQA
NT seq 6714 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggctacccccaatgggagcgccgtgaatggtccgtcagacatctacgaccat
tccaaagttgcccagtttattggcgctaactctgttgagtcggcaccttctggccgggta
accgactttgtcaaggctcacaacggtcacactgttatcaccaaggttttgatcgccaac
aatggtattgccgctgtcaaggaaatcaggtccataagaaaatggtcttacgaaacgttt
ggctctgagcgccaaattgaattcactgtcatggccactccggaagacttacgaatcaac
gcggagtatatccgtatggcagaccgatacgttgaggtccccggtggaagcaacaacaac
aactatgccaatgttgatttcattgtggatgttgcggaacgagccggtgtacatgctgtc
tgggcgggttggggtcacgcctctgaaaaccctcggcttcctgagactctcgctaagtcg
aaaatcgtctttatcggtcctcctggatctgctatgcgatcccttggtgacaagatctca
tccaccattgttgctcagcacgcgaaggtcccctgtatggcatggtccggtaccggcatt
tctgacacagtgctttccccccaaggcttcgtgaccgttcctgacaaggcctacgatgac
gcttgcgttcacaactgggaggagggtcttgagagggccgagaagattgggttcccggtc
atgatcaaggccagtgaaggaggtggtggtaagggcattaggaaggttgaggacggggag
aagttcaagaatgcgttccaggccgttgctggcgaagttcctggatcacctatcttcatt
atgaagcttgctggatcagctcgtcacttggaagttcaacttatcgctgatcaatacggt
aatgccatctcccttttcggtcgagactgctccgttcagcgacgacaccaaaagattatc
gaagaagcgccagtcactattgccaagccggatacatttgaggagatggagaaggctgca
gtccgacttgccaaattggtcggctacgtctctgccggtacggtggagtacctctactcc
cactctgatgatagcttctacttcctcgaattaaacccccgtcttcaagtggagcatcct
actactgaaatggtcagcggttgtaacattcccgctattcaactccaggttgcgatgggt
atccccctccaccgaatccgagatatccgtactctctacggtatggaccctcatggcatc
accgaaattgatttctacggcagtaagcctgagtcggttaacactcagcgtaagcctact
cctaagggccatgtcattgcttgtcgtatcaccggtgaaaatcccgatgcgggattcaaa
ccttcttccggtaaccttactgagctcaacttccgctccaactccaatgtctggggttac
ttttccgtgtcctctgcgggtggtctccatgaatacgccgactctcaattcggccacatt
tttgcctacggcatggagcgaagcgaggctcggaaatctatggtcgtcgcgctcaaggag
ttgagcatccggggtgaattccgaacgacggtcgaatacttaattaaattgctcgagaag
ccagagttcgaaaacaacactcttaccacccaatggcttgatggccttatcgcggagggt
atgacttctgagcgcccggaccctgtcgtcgctgttgtttgcggtgctgtagttaaggct
tacattgcgtacgaagcgtcacttgctaagtacaaatcggtacttgacaagggtcaagtt
ccctccaaggactccctccagacgttctttaagagtgaattcatttacgagaatgtgcga
tattcatttgccatggccaagtcttctgcctactctttcactctttacctcaacggtggt
cgtatttttgtcgggtgccgaggtctcagcgatggtggtcttttgatctctctgggcggt
gcttctcacacagtttacttccgagaagaagttggcgccatggtcctttccgtggactcc
aagaccacacttatcgaagatgagcaagaccctagccagctccgaagcccttctcccggt
aaacttgtgcggtacctcattgactctggtgaccatgtcaatgcgggtgatgcctacgct
gagattgaagtcatgaagatgattatgcccgtaactgccagcgagagcggtatcgctcaa
ttcatgaagcaacctggccagaccttggccgccggcgagttactcggtatcttgaccctc
gacgatcctaccaaggtcaagttcgctaagcctttcgagggtattcttccaacctttgaa
ttaaaggacggtcgatacggtacgaagcctcatcagcgtttgcgcgagcatcttgaagtt
ctttacgacaacctttccggctacgataacagcgcctctgtcctttcttcacttcgcatc
gtcgaggctgcccttcgtgatgccgatcttccgtactctaacgctcaaggggtcatgtct
accctcagcggtcgtatcccccagaagctcgaggaagatatccgcagcactttggattct
tgccgtgctaaacagcttgagttccctagcctcaagcttcaacatatcattgatgtgttt
gtcgaagaaaacgtcatgcccaaagagcgccctcaagttattgcagccatttctcccctc
aagactttgattgatgcctttgcccatggacttaaagttcacgagtggcagacttgggcg
gacctgcttaacttctttgccgatgtcgaagaacctttcgccgacaccgctcgtacccaa
gagaacgtcattctcaagcttcgagatgattgcaaggaccttgatcaggtagttaatctc
gtcctttcccacagtaagattgctttgaagaccaagttggtccttgctttgcttgacatt
atcaaatctgaatcacctcgtgcttccatgactcctgagagccgtgtcaatgacgctctt
ggccgacttgcggctcttgacagtcgacccacagccaaggttgcactcaaggctaaggaa
gtgatgattgtcggatctctcccgagctatgaggagagactcggtcagttggagaggcta
ctcagcgctgctgtcactaccagctactacggccaacaaggctccggccatcgattacct
tcgggtgatgttctcaaggaggttaccgactctcgttacaccgttttcgatgtgctcacc
acgttcttcgatcatgatgatccttgggttgcccttgctgcccttgaagtgtatgtccga
cgagcatatcgtgtgtacaacgtcttgcaccttgactacgaagcaggtgaaaaaggtggc
gagccccatatcatcacgtggcgattcaaacttggcggtcaccaaagtgagcccatcacc
cctcgcgttgactctaccaaggatttcactcgtatcgccagcatgtctgacctcagctat
gttgtcaacaccaagactgagcctgtccgatttggtctcatgacttcatacaatgatttg
gcttctcttgagcaaggctttgctaagctcctctccatgtatcccgccttcagccatgtt
gaacacatcgaaaaattcggcggcgacgcccgtcatccccatgttatgaatgtcgcccta
cgtttgttcaatggtgaacaaatgtctgacattgagctcaatgtgcgattccacgctctt
gcgaaccgatatgctacgggaattagtggaaagggtatccggagagtaagcttcgtaatc
tgccgcaaggatcagtacccagcgtatgtgactcttcgcgagtccgccgagggcagctgg
aaggaggaagaagctatcagggacatcgaacctgctcttgcttatcagctcgaacttgga
cgactctccaacttcaagatcactcctcaaccttcttcaaacagacaaattcacgtctac
catgctgtaggccgcgagaacacttctgatgttcgcttctttgtgcgagcacttcttcga
ccgggtcgtttccaaggaaacatgcaggtcaaggagtaccttatctctgagacagaccga
cttgtcggtgacatcctcgatacccttgaagttgtcagctcccagcaccgacaagccgac
tgtaaccacatcatggtcaactgtgtctacaacctcaatgtcaccttcgacgacatccag
gaggcgctggctggtttcattgagcgccatggcaagagactgtggaggttgcgtgtgacg
caggcggagatcagagtagttattgaagacgaggaaggaaacgttttacccattcgatcg
ttcattgagaatgtctcaggctttgtagtcaagtatgaggcctatcaagaaattgataac
gacaagggcaagtccatccttaagtccattggcgaaaacggtcaattccatcttcagccc
gtcaacttcccttattcgaccaaggagtctctccagcctcgtcgataccaagctcatgtg
atcggtaccacttatgtttatgacttccccgaccttttccgacaggcgactgacaaagca
tggcataacctccaggctttcctgcctaacattaagatcccgtcagacttgcttactgcc
accgaattggtctctgacgagcgtggtgagttgcaggaagtgactcgtgctcctggcctc
aacacttgtggcatggtcgcttgggtgtacaccctcaagacgcccgagtatccccaagga
cgtcgtgtcgttgtcatctctaacgacatcacctaccagattggttccttcggtccagct
gaagacgagttcttctacaaggcgacccagtatgcccgtaagcatggccttcctcgaatc
tacctctccgcaaactctggtgctcgtattggcctggctgaggaagtcatggctcttttc
gatgtcgcttggcatgaagctggtaagcctgaaaagggctttgactatctctacctcact
cccgccaaccttgagaagcttaatgatatgggctccggtagtgtgatcaccgacgaaatt
gaggtcaatggtgagaggaggcataagatcgtatccattattggtctcaaagacggtttg
ggtgtcgaatgtttgcgaggttctggtttgattgcgggtgaaacctctagggcgtacgac
gacatctttaccatttctatggtaactgcacgatcagttggcattggtgcctatcttgtc
agattaggacaacgtgttgttcaggtggagggtcagccaattatcttaactggtgctcaa
gctatcaacaaagttttgggtaaggaggtgtacacgagtaacatccagttgggtggtcct
cagatcatgtacaagaacggtatctctcacttgactgcgggcagcgatctcgatggtgcc
ctacaaattatcaattatttgatgttcattcccgagcaacgaggtcgagccattcctatc
ctccctactggtgaccactgggaccgagccgttgagtggaagcccaccaaggccgcttat
gatcctcgaaacttcttgtccggttgcaatgaggatgttgacggcgtgcagagctggaaa
tctggtatcttggataacggcagtttctttgagaccatgggcggctgggctcagaccatt
gtgactggtcgaggaagaatcagtggtatcccagtggcagttatcgccgccgaaactcga
tctatcgagcgcgtcgaccctgccgaccccgcgaacgaaaactctcaagaaaaccgtgtt
tcgcttgctggtaccgtttggttccccgacagctccagaaagactgctactgccatcgag
gatgccaaccgagaaggtctcccactggtcatctttgccaacttccgaggtttctcaggt
ggtatgtccgacatggcgcaagccattcttaaggaaggtgccaagatcgtcgacggtctc
agtagctacaaacatcctgttattgtctacctcgtgcctaacggcgaattgcgaggtggt
gcatgggtagtcttggacccatccattaaccctgagcacatgaccatgttcgtcgacaat
gagtctaggggtggtgttttggaacctgagggtatcgtagaagttaaatatcgtaagcca
aaggtccaggctaccatggctcgattggatgaggaatatgcccgcctcaagaaggaagtt
gagaaccccaacgcgtctcccgaacagaagactgcggcgacagctaagcttgaggctcgt
gagaaacatctcggccccgcttaccaatccgtcgcccttgaattcgccgatctccacgac
cgaagtggtcgaatgaaggccaaagccgactgtactccctgtgactgggagaactctcgt
cgtgctatctactggtctttgagaaggaagctaagcgagattcgtatccttaagaagctt
gaaaacgccaaccctcgcctaacttatcctcagcgaaaagagcttctccagcagttcgtt
cccgccgaactttccagtgacagcgaagtggcggcgtacatcgaaaaatctggagagact
attgagtcattcatccagggtgtgcgcgacgaatggtgttctgacactttggtttcttgg
gctggaaccaaccaggacggagtcatgtctggtttcaagaggatcttagaaggtctctca
gtggagcagaaggcacaggtgctcgccgagcttggggtgcaaagccaagcttaa

DBGET integrated database retrieval system