KEGG   Cryptococcus gattii: CGB_F5040WHelp
Entry
CGB_F5040W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CGB_F5040W
Messenger RNA biogenesis [BR:cgi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CGB_F5040W
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CGB_F5040W
Translation factors [BR:cgi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CGB_F5040W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(955210..955388,955508..956206,956257..956377,956425..956817,956868..957215)
Genome map
AA seq 579 aa AA seqDB search
MGNETPTDLISGTSSRPVSHRPLSANSHRSFGDENEKKGLMLPPPIPVKTNKGQEEKSVP
PRMTRLPSLKQLSERLQSTSSNPSSQQPNSLDKSPASSSSNPLRISTNPVALQSSSIASH
TSPIMTPTSTGRLKLPASAMMRSLSAGSNGSAPSGLSPIISSPVIASNLGSVQGQGHSPT
SAHPLTPAQQLAKFVPGGLGDFHPASGPESSTSMSRSASHEVRVEHLREIPSLDEIRRKV
KINKREDQPKSDLPNERIKEKKEGKSFVESTDKAMSVASAESEKKEHPLQHSWTLYYDSK
TYKPDPSLIAPRQGDKILADYEMTLLTVGKFDTVEGFARHFNNVRLPSQLTPSSNYHLFK
DGIRPMWEDPANADGGKWVILFRSSPGTLDIAWANLTMALVGEILDPENQVCGIVGSARP
KVDRLQVWTRSKDDVESLNQLGKRIVEIMALEGRDADSMSMEYQYNTNDSRPPPNRFIHI
SYSNRAPPTPSRAMSSAFQGPPGSFGGMGQAQTLSSSGVNLTHPLPLPPHSPAVIKGDHG
SANDAAGMKRGLTNGNPFAGPLDLVRQGNYGSKEGMTGV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaaacacccacagacctcatctcgggaacctcctcaaggcctgtctctcat
cgaccgctttccgcaaactcccatcgtagttttggagacgagaatgagaagaaggggctt
atgttgcctcctccaatacccgtcaagaccaataagggacaggaagaaaaatcagtacca
ccacgaatgacccgtcttccttctcttaaacaattatctgagcgcctccagagcacatca
tcaaatccttcgtctcaacaacctaattcactcgacaaatcaccagcttcatcaagttcc
aatcctcttcgcatctccacaaacccagttgctctccaaagctcatctatcgcttcccac
acatcacccatcatgacacccacgtcaacagggagattgaagctgcctgcaagcgctatg
atgagatcactttccgctggatccaatggttctgcccccagcggcttgtcacccatcatc
agttcgcctgtaattgcatctaaccttgggtctgtccagggccagggtcattctcctact
tctgcccatcctctgacccctgctcaacaactggctaaatttgtgccaggcggcttgggc
gactttcatccagcgtctggtccggaatctagtaccagtatgtcacgttcggccagtcac
gaggtgcgtgtggagcaccttcgagaaatcccatctttggatgaaatcagaagaaaagtt
aaaattaataagagggaggatcagcccaagtcggatttgcccaacgagagaataaaggag
aaaaaggagggcaagagctttgtggagagtactgataaagcaatgtctgttgcctcagcc
gaaagcgagaagaaggaacatcccttgcaacactcttggacattatactatgactccaaa
acatacaagcctgatccgtccttaattgctcccaggcaaggggataagattctcgccgac
tacgagatgacactcttaaccgtcggcaagtttgatactgtcgaaggcttcgcgcgacat
tttaacaacgtccgtctcccaagtcaactcaccccttcatctaactaccacctcttcaag
gacggtatccgacctatgtgggaagatccagccaacgccgacggtggtaaatgggttatt
cttttccgctcatcacctggaacgctcgatattgcctgggcaaacttgacgatggcgctc
gtcggtgagattcttgatccggaaaatcaagtgtgtggaatcgtgggcagtgcgagaccc
aaagtcgatagactccaagtatggacaaggagtaaagatgatgtggagagtcttaatcag
ctagggaagaggattgtggagattatggctttagaaggcagagatgccgatagcatgtct
atggagtaccaatacaatacaaatgactcccggccgccacccaacagattcatccacatc
tcttattccaatcgtgcgccacctacgccttcgcgagccatgtcatccgctttccaaggt
ccaccaggatcattcggcggcatgggacaggcccagacactctcatcgtcaggcgtcaat
ctcactcatcccttaccgctcccaccgcactcaccagctgttattaagggggatcatggg
tcggcaaatgatgcagcagggatgaagagaggattgactaacgggaaccctttcgcggga
ccgttggatttagtgagacaagggaattatggttcgaaggaaggtatgaccggtgtgtag

DBGET integrated database retrieval system