KEGG   Cryptococcus gattii: CGB_G0160WHelp
Entry
CGB_G0160W        CDS       T02232                                 

Definition
ubiquitin carboxyl-terminal hydrolase 6
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_G0160W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_G0160W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:join(44265..44391,44445..44482,44548..44583,44637..44703,44766..45198,45249..45425,45480..45554,45602..45662,45729..45948,46007..46224)
Genome map
AA seq 483 aa AA seqDB search
MLTYNRVVSVKHSGKTYTVPVTQEITTHAFKDAISQLTRVPTERMKVMVKGKLVKDDTDY
VTLANQKQTVMVIGAAEALPPPPTEQTVFLEDVEDEDIKSDEPTGLINLGNTCYLNSTLQ
AIRAIPEVHQALTEFTPSSSSSSFVPESRVANSLKNLFITIDNTPNAVPPLEVISNLRIL
APQFAERDQRGQYAQQDADEAWTQLVQALRAALPKNGEEGSVVDRLMSIELTKTLKNAET
EEEPETTSTETVLKLECNISGSTNFLMSGIQDSLNQQVEKTSATLGRNATYSMQSRISRL
PEYLVVHMVRFYWRRDIQKKAKIMRKVKFPLQLDLSDIVTEPIRKKIQPLNTATKQILKE
RDARASILKRKPGQGLDEEKKKRGEEQATVENLVKEGGLTNGERSGMYELAAVVTHKGAS
ADSGHYIGWSRIDDGAYVPAEQQRWAKFDDNNVTFTDANKILTMDGGGEDSVAYILLYRA
AKI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgctgacatataaccgagtagtaagcgtaaaacattcgggcaaaacgtacaccgttcct
gtcacacaagagattacaactcacgctttcaaggatgctatctctcaacttactagggtt
cccaccgagaggatgaaggtcatggtgaaaggcaagctggtgaaggatgatacggattat
gtcactttagcaaaccaaaagcaaactgttatggtgattggcgccgctgaagcgttgcca
ccaccaccaactgagcaaaccgtctttttggaagacgtagaagatgaagacattaaatcc
gatgaacccacaggtctcatcaacctcggtaacacatgttacctcaactccacgctccaa
gccatacgtgctatacccgaagttcaccaagctctcacagaattcactccttcttcctcc
tcttcttctttcgtccccgaatcgcgcgtcgccaattcgttgaaaaatttgtttattacg
attgacaacacacctaatgccgttcctcctttggaagtcatcagtaatttgagaatcttg
gcacctcaatttgcggaaagggatcagaggggacaatacgcgcagcaggatgcggatgag
gcctggacacagcttgtacaagcgttaagggcggcgttgccaaagaatggagaggaaggg
tctgtggtggaccggttgatgtctatcgagttgacaaagacgctcaagaatgcagagaca
gaggaagaaccagagacaactagtacggaaacggtattgaaactcgagtgtaacatatct
ggatccacaaatttcttgatgtctggtattcaagacagccttaaccagcaggttgagaag
acaagcgcaacattgggacgaaacgcaacttattctatgcagtctcgcatttctcgtttg
ccggagtaccttgtagtgcacatggttcgattttattggcgtcgtgacatccagaaaaaa
gcaaagatcatgcgcaaagtcaaatttcccctccaactggacttatctgacatcgttacc
gaacccatccgcaaaaagatccaacctctcaacacagcgacgaaacaaatcctcaaagaa
cgcgatgcccgtgcgagtatcttgaaacgtaagcccggacaggggttagatgaagaaaaa
aagaagagaggcgaagaacaggctacggttgagaatcttgtgaaggagggagggctgacc
aatggggagaggagtggaatgtacgagctcgcggctgtggtaacgcataaaggcgcctct
gccgactctggtcactacattggctggtctcgcattgatgatggtgcatacgtccctgct
gaacaacagagatgggccaagttcgacgataacaatgtgacctttacagatgcgaacaag
attttgacaatggatggaggcggtgaggattcagtagcttatattttgctttatcgggcg
gcaaaaatctag

DBGET integrated database retrieval system