KEGG   Cryptococcus gattii: CGB_G1260CHelp
Entry
CGB_G1260C        CDS       T02232                                 

Definition
(RefSeq) histone-lysine N-methyltransferase
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cgi  Cryptococcus gattii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CGB_G1260C
Enzymes [BR:cgi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CGB_G1260C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(join(264709..265191,265244..265756,265808..265999,266050..266157,266204..266311,266379..266464,266512..266615,266665..266840,266904..267027,267091..267177,267234..267345,267446..267854))
Genome map
AA seq 833 aa AA seqDB search
MGDVIEDTKPTLDDLWAEDENQKPETPPTPLSRSPSSKHEHKSPFPGSTSPPSASPIGEE
DLKPRTARASSSTSKTKSRKASPEVFKPVLIDDLPTAWDEAHETFEALEKCVYERKDIGL
SKENDEMMVCECVYNRHDPDTDPCGPDSDCINRALYIECIAGECRAGKHCHNQQFSKKQY
ANVDVVLTEKKGYGLRASSIIPANTLIYEYIGEVVAEKTFRKRMQQYADEGIRHFYFMML
QKEEYIDATKKGGIGRFANHSCNPNCEVQKWVVGRRLRMGIFTKRDVVKGEEITFNYNVD
RYGHDAQTCYCGEPNCVGTIGGKTQTDISTMNDLFLDALGITDEVEAMGMKGSKKKKSRQ
LDEDFVPILRPIGAHEVQKVAAAIRQSMENKNMMSRLLQRIQMTDDGAMHRQLMRMHGFS
LMYMVLTELADDKEIVLLALESMNKWKLQIRNKIEDSNIEEPVKVLGRSEDETICGLAKQ
LIEYWSTLELSYKIPRVSKIASLDADDEAGTQTIAEANVVSAARRPDAWENTQEIQIDIA
PVRPRTLPVSRPRPPLPPPPPVKKPALNSVASTDRLKLDAIIAMAEQTVQAQAAAAAVEA
TASLQAGSSRSGSRPAEDEERRKRQKRTHMTEEELAEQKERRLRKLIGAVVVKSMNKYKD
MIEHDTFKKYARECTDTLVKKEKKSPSYQGAKYPSLSDDKKAKIKSFTKDYTHKILKHLK
EKGKLLNPKSSSTLKTSGNDPNHAASSSTNGDTPGISTPSQGGVSLEAAQSLRDGELMDD
IFGADEDMAMDLDEDASQMQEDHPVSPSIPPATPPLPPVRIEVVDSSSTPASQ
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgttatcgaagatacaaaaccaactttagatgacctctgggcagaggatgag
aatcagaagcccgaaacgccgcctacaccgctatcaaggtctccatcctccaagcacgag
cacaaatccccatttcctggatcgacatcccctccttcggcatcccccataggtgaagaa
gatcttaaacctcgtacggccagggcatcgtcttcaacgtcgaagacgaagagcagaaag
gcttccccagaggtgtttaagcctgtgcttatagacgatcttccgacagcgtgggatgag
gctcatgagacgttcgaagcgctggagaagtgcgtgtatgagaggaaagatattgggttg
agtaaggagaacgatgagatgatggtgtgcgagtgtgtctacaatagacatgacccagac
actgacccttgtggacccgattccgattgcatcaaccgtgcattgtatatcgagtgtatc
gcgggggaatgtagagcgggcaaacactgtcataatcagcaattctcaaagaagcagtat
gccaatgtggatgttgtccttacggagaaaaagggctacggactgagagcgagctcgatc
attccagcgaatacgctcatctatgagtatattggtgaagtggtggcggagaagacattc
agaaagaggatgcagcagtatgctgatgaaggcatacggcatttctattttatgatgctt
cagaaagaagagtacatcgatgcaaccaagaagggcggcataggtagattcgctaatcac
tcctgtaaccccaattgtgaagttcaaaaatgggtggtgggacgtagattgcggatgggt
atcttcacaaagagagatgtagtcaaaggcgaggagattacttttaactataatgtcgac
cgatacggccatgatgcccaaacttgttactgtggagagccgaattgtgtcggaaccatt
ggtggaaagactcagaccgatatcagtaccatgaacgatctgtttttggatgctttgggt
atcacggatgaagtcgaggctatgggtatgaaaggcagcaagaagaagaagtcaagacaa
ctggacgaagactttgttcctattcttcgacccattggtgcccacgaggtccagaaagtt
gctgctgccattcgccagtctatggagaataaaaatatgatgtcgaggttattacaacgt
atccagatgaccgatgacggcgcaatgcaccgacagcttatgaggatgcacggtttcagt
ctcatgtacatggtgttgactgagctggcggacgacaaggaaatcgtgcttcttgctctc
gagagtatgaacaagtggaaacttcagatacgtaacaagattgaagattccaatattgaa
gagcctgtcaaagtgcttggccggagcgaagatgaaacaatctgcggcttggctaagcag
cttatcgagtattggtctactctcgagctttcttataagatccctcgtgtctccaaaata
gcatctcttgatgccgatgacgaagcgggtacacagaccattgctgaagccaacgtcgta
tctgcagcccgtcgtcctgacgcttgggagaacactcaagaaatccaaatcgatattgct
ccggtccgtcctcggactttgcctgtctcacgccctcgccctcctctaccaccacctccc
cctgttaagaagcctgctctcaattcagtggcctccactgatcgtctaaaactcgatgca
attatcgctatggcagagcagactgtccaagctcaagcagctgccgcggctgtggaagcg
acagcttctcttcaagcaggctcaagtaggtccggaagccgacctgcggaagacgaggaa
agaagaaagaggcagaaaagaacgcatatgacagaggaagagctagcggaacagaaggag
aggagattaaggaagctcatcggtgcggttgtcgtcaagtcaatgaacaaatacaaggat
atgattgagcatgatactttcaaaaagtatgccagagaatgcaccgacaccctggtcaag
aaggagaagaaaagtccttcttatcaaggcgccaagtacccttcactatctgacgataag
aaagccaagatcaagtcctttaccaaagactacactcacaaaatccttaaacatctcaag
gaaaagggcaaacttctcaatcctaagagctcctcaaccctgaaaactagtggcaacgac
cccaaccacgctgcatcatcatctaccaatggcgatactcccggcatatctactccctca
cagggcggtgtatccttggaagctgcccaaagtcttcgagatggagagttgatggatgac
atctttggcgctgacgaagatatggcgatggaccttgacgaagacgcatctcaaatgcaa
gaggatcaccctgtgtccccttcaattcctcccgctacacctcctttaccgcctgttcgc
attgaagttgtagatagcagctcaacacctgcatcgcaatag

DBGET integrated database retrieval system