KEGG   Cryptococcus gattii: CGB_G1380CHelp
Entry
CGB_G1380C        CDS       T02232                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CGB_G1380C
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_G1380C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(join(298522..299115,299168..299298,299357..299615,299667..300881,300928..301125,301172..301596,301649..302710,302771..303137))
Genome map
AA seq 1416 aa AA seqDB search
MSSQDLPGTLKRPRSTSRPPSPSSGSSPKRAASEDPFPSSSDSGRLFDHLITDNSGMVAA
SSPLRQDIGDNESNKSWVELTQQVKLGSDGEEDMKGDITLRADGEPTLVSQEIWKERNNE
LLGLLPPPFNHYERYHILPKSIIQKVQLLALSDANDPAVQPEDFAEAMEKLVPDHSAESF
WVIQSEKTTAGHKLIGKAKKEDVWALGDAEENEDYVFVPEAGWQKVLEWFGPYDGPSLPR
YCVPPDNIEIIPGNLRLFIVFPADTIATTNQPDESIQSVLLAPSTTPIKTFESFAVSVCN
QEIDPSKLAGQWATRLWKIEKSGENDESLLKSGSLEITPKALISTKCELIDTSNAEENLA
EAILGSSKSQIVAIEFGKIPEGSSTPVWNVEVNSDKQAIEKSNKPAPLFSKPAFFSGSGK
AATESASTTDAIQTRSQTKERKGKGLVGLQNLGNTCFMNSAVQCLSNTKELSQYFLSGVY
TDELNRDNPLGMQGQIAEAFGQVVENLWAPSSSMHSSYSPRQLKWTTSRFAPQFAGYGQH
DTQEFIAFLLDGLHEDLNRILKKPYIEKPDWKPGGGDKELAELGKECWDGYKKRNDSVIV
DLFQGQLKSTLVCPECHKESITFDPFMYLTVPLPIAQNRQFKVTFVPRDTEKPPVNVKLL
IPQNASFAQVKDKLGSLFDCKGSSILGFDLWNNRPYAWWADSDHNSEAKDTDEAIFYELE
PSVSVSVSRGRFGSQPRTVSQDGSLTVPVYTFRTVESSRGGYRAGDVPSDLSLKPFFITL
TKDEASDPVAVREAIMRGYARFIKPHAKENIYVPAFSAEARAPTPPKSDDGDSVTVIHMN
DDQPTVVEVPSSQQSSADISTPVMEDASMEVDSAPSTMAVTGLQLNGSTTSLLSTQSIKS
STSSSGKLVPRADLFRVYVADPAGDFSFKNFGSSEKKNDAAHLYDKDITSASRSWSLLES
RKKKAKKHIVNRLASGISSMVNPSNNSEDEALSDASTATSPSKVEKKKEKLANSKLVVRP
GEGIFCEWSGADFAEWLNDNVKGEDVIDPAISKDLAKKREGKQIGIEDCLDEFSKEETLG
QDDLWYCPVCKKHQAATKKLEIYKAPDILVICIKRFGSSRRMGDKLDNLVHFPIDGLDLE
DRIGERQVAKTLKLSGEDVEAYGIEDDGEPLLYDLYAVDNHFGGMGGGHYTAFCRNQVDN
QWYNYDDSRVSKADVSSVQSRAAYLLFYRRRTSRPIGGESRIKAEEAARNVASAPASPDA
GAPKESSTMPSTAFVSARTTPTRELSPDLSSDELPSYSQVPSPPTLGTSAPPSPTVSDDS
FPAPETYSRGVDIASVGQSIGFGNTAWGTPAKVPESGHSFGTMTRAEWLDSSAQPVDMER
LSTNTDVEDRSNVLTALQDDEDTRETKDEDVEMELQ
NT seq 4251 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcaagacttacccggcacactcaaacggccacgctccacttcgcgccctcct
tctccatcctctggctcatccccaaaaagagcagcttccgaagatccatttccatcaagt
tcagactcgggacgcttattcgatcatctcataactgataacagcggcatggtagctgcg
tcaagcccgctgaggcaggatattggagataacgagagcaacaagagttgggttgagcta
acgcagcaagtcaagctcggatctgatggcgaagaggacatgaaaggcgatataaccttg
agagcagacggtgagcctaccctggtatcccaggaaatatggaaggaacggaacaatgag
cttttaggattacttcctcctccattcaaccactacgagagataccacattctccccaag
tccatcatccaaaaggttcagctccttgcccttagcgacgccaatgaccctgcggttcag
cctgaagactttgcggaagctatggagaagctcgttcctgatcactcagccgagtccttt
tgggtcatccagtctgaaaagactactgcaggtcacaagcttataggcaaagccaaaaag
gaggatgtttgggcgctaggggatgcggaagagaatgaggactatgtgtttgtgcccgag
gccggctggcagaaagtacttgagtggtttggcccgtatgatggaccttccttacctcgc
tactgcgtgccccctgacaatatcgagatcattcctgggaaccttcggcttttcattgtc
tttcccgctgacaccatcgctacaacaaatcaaccggacgaatctattcagagtgttctc
ttggctcctagcacgaccccgatcaagacatttgaaagctttgctgtgtcggtctgtaac
caggagattgaccctagcaaacttgccggtcagtgggcaacccgtttatggaagattgag
aagtcaggcgaaaatgacgagagtcttctcaaatctgggtctcttgagatcactcccaag
gcactcatctccaccaagtgcgagcttattgacacttcgaatgctgaagaaaaccttgcg
gaggcgattctaggcagttcaaagtctcagatagttgctatcgaattcggcaagattccc
gagggctcctctactcccgtttggaacgtggaagtcaacagcgataagcaagcaattgaa
aagagtaataaacctgctcctcttttctcgaagcctgccttctttagtggatccggaaaa
gcggctaccgagtctgcttctactacagatgctatccagacaagaagtcaaaccaaagaa
cgaaagggcaagggtctggtcggtttgcaaaatttgggtaacacttgtttcatgaatagt
gctgtgcaatgcctgagtaacaccaaggagctttcccaatacttcctctccggtgtatac
actgacgagcttaaccgtgacaatcccctcggtatgcaaggtcaaatcgcagaagccttt
ggtcaagtggtcgaaaatctctgggctccttcttcgtctatgcacagctcctactctccc
cgccagctcaaatggactacttccaggttcgcccctcagttcgctggctatggacagcac
gacactcaagagttcattgctttcttgttggatggtttgcatgaggacttgaacaggatt
ctgaagaaaccgtatatcgagaagcccgattggaagcctggtggtggtgacaaggagttg
gctgagcttgggaaggaatgctgggacgggtacaagaagagaaacgacagtgtcattgtc
gacttgttccaagggcagttgaagagcaccttggtttgtcccgaatgtcacaaggaatca
atcacgtttgaccctttcatgtaccttactgtgcctctgccgatcgcgcagaacagacaa
ttcaaggtcacctttgttccacgagacactgaaaagccacctgtcaatgttaagctcttg
atccctcaaaatgcctcatttgctcaggtcaaggacaagcttgggtcattgtttgattgc
aaaggctctagtatcctcgggttcgacctctggaataaccggccttacgcttggtgggcc
gactccgatcacaacagtgaggccaaggacaccgatgaagctatcttctacgagctcgag
ccatctgtctccgtttccgtgtccaggggaagatttggttcccaacctcgaacagtcagc
caagatggctcgttaactgtccccgtctacaccttccgaactgtcgaaagctctcgaggt
ggctatcgagccggcgatgtcccttcggacctctcgctcaaacccttctttatcaccctt
actaaggatgaggcgtctgatcctgttgccgtaagggaggctatcatgcgcggttacgcg
cggttcataaagccccacgcgaaagagaacatctacgttcccgcctttagtgctgaggct
agggctcctacaccacccaagagcgacgatggcgactctgtgacagtgatccacatgaac
gatgaccagcctactgtggtagaggttccttcatcccagcagtcttccgcggacatttca
acaccagtcatggaggatgcgtccatggaagtggactctgctccctccacgatggcggtg
actggtctccaacttaatggatctacaacttcccttcttagcactcaatccattaaatcc
tctacttcttcatccggcaagctggttccgagagcagatcttttcagggtttatgttgct
gatcccgctggcgacttctcctttaagaatttcggatcgagcgaaaagaagaatgatgct
gcccatctttacgacaaggatatcacttccgcctctaggagttggtctttgcttgagtct
cgcaagaagaaggcaaagaagcatattgtcaatcgacttgcttccggtatcagttccatg
gtcaacccttccaacaactccgaagatgaagcgctgtctgatgcatccactgccacatca
cctagcaaggtcgagaagaagaaggaaaagttggccaactccaagctagtagtaagacca
ggagaaggtattttctgcgagtggtcgggggccgactttgctgaatggctcaatgataat
gttaagggcgaagatgttatcgatcctgcgatttccaaggatttggccaagaagagggag
gggaagcagattggtattgaggattgtttagacgagttctcaaaggaggagacccttggt
caagacgacttgtggtactgccctgtctgcaagaagcaccaggctgccaccaagaagcta
gaaatctacaaggctccagatatccttgttatctgtatcaagcgattcggttcttcacga
cgtatgggcgacaagctcgataacttggtacacttcccgattgatgggctcgatttggaa
gacaggattggtgagaggcaggtggccaagactctgaagctcagtggagaggatgtcgag
gcttatggtatcgaagacgatggcgaacccctgctttatgatctttatgctgtcgacaat
cacttcggtggaatggggggaggccactacactgccttctgcaggaaccaagtagataac
cagtggtacaactatgatgactctcgagtttctaaagccgacgtttcttcagttcagagt
cgtgccgcctacttgctattctaccggagaagaaccagccggcccatcggcggcgaatcg
aggatcaaggctgaagaggccgctcgcaacgtggcatccgctcctgcttctcccgatgcc
ggagcacccaaggagtcatccaccatgccctccacagcttttgtctccgcccgtacgacc
cctacacgggagctttcacccgacttatcatcggacgagctcccttcgtactcgcaagtg
ccctctccgcctacactcggtacatctgcgccccctagccctacggtcagcgatgattcc
ttccctgcaccggagacgtatagccgaggggtcgatatcgcttctgtaggccaatcaatc
ggatttggaaacaccgcatggggtacgcctgccaaggtaccggaaagtggccattcgttt
gggacaatgactagagccgagtggcttgactcttcggcacaacctgtagacatggagcgg
ttgtctacgaatacggatgtggaggatagatctaatgtattgaccgctctccaagatgac
gaagatacacgtgagaccaaagacgaagatgtggaaatggagttacagtag

DBGET integrated database retrieval system