KEGG   Cryptococcus gattii: CGB_G6110WHelp
Entry
CGB_G6110W        CDS       T02232                                 

Definition
mannitol-1-phosphate dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CGB_G6110W
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_G6110W
  Lipid metabolism
   00071 Fatty acid degradation
    CGB_G6110W
  Amino acid metabolism
   00350 Tyrosine metabolism
    CGB_G6110W
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CGB_G6110W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:join(1167919..1168339,1168450..1168581,1168639..1169290,1169352..1169418)
Genome map
AA seq 423 aa AA seqDB search
MMTMSSMRILRFTAVQPITRLLPKSTHIRPIPSPLSTAYLYHPSISSISKTTSRTIHTTQ
AKMSTLSNFTIPKTQTAAVVKATGAELAIDKEHPVRQASELKPGECLVKISYTGVCHTDL
HAKSGDWPVPPSHPLIGGHEGVGIIVAIGDHTAASPVKLGDRVGIKWLADSCLSCELCRR
GYEMNCPNVKLSGYTTDGTFSEYVVSFVNHVTPIPEALDSAGAASILCAGVTTYKALKVS
NTKVNDWVALPGAGGGLGHLAVQYAKAMGLRVVAIDTGAVKEKLVKSLGADAWVDFKTSK
DIVADIKAATGGDGPAAAVVTAANRTGYTQAVEYLKPSGTLVAVGMPDAEMGANVFWTVF
KNIRIQGSYVGNRQDAIEALDIAASGRVRVVFEEKGLESLKDVYEDLEAGRIAGRVVLKV
SDE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaatgtcgtccatgcgaatcttacgcttcacagccgtccaacccattacccgt
ttacttccgaagtcaacccatataagacccatccccagccctctttctacggcttatctt
tatcatccatccatatcatccatatccaaaactacatctcgtaccattcatacaacccaa
gcaaagatgtctactctctccaacttcaccatccccaagacccagactgccgctgtcgtc
aaggctaccggcgcagaactcgctatcgataaggagcaccctgtcagacaagcctccgag
ctcaagccaggcgagtgtttggtcaagatctcctacactggtgtctgccataccgattta
cacgcgaaatctggtgattggcctgttcccccatctcatccccttatcggtggtcatgaa
ggtgtcggtattattgtcgctatcggtgaccatactgctgcttctcccgttaagcttggt
gaccgagtcggaatcaagtggctcgccgacagctgtctcagctgtgagctctgccgacgc
ggctatgagatgaactgtcccaatgtcaagctttctggttacactaccgacggtactttc
tccgagtacgtcgtctcgttcgtcaaccacgttacccctatccccgaagcccttgattct
gcaggcgccgcttccattctctgcgctggtgttaccacatacaaggctctcaaggtctcc
aacactaaggttaatgactgggtagctcttcccggcgctggtggtggtcttggtcatctt
gccgtccaatatgcgaaggcaatgggcctcagggtcgtcgctattgataccggcgctgtc
aaggagaagctcgtcaagtctctcggtgctgacgcttgggtcgactttaagacttccaag
gatattgtagccgacatcaaagctgcgactggtggtgacggtcctgccgccgctgtggtt
accgctgccaacaggactggttacactcaggctgtcgagtatctgaagcctagcggtaca
cttgttgctgtcggtatgcccgacgctgagatgggcgcaaacgtcttctggacagtgttc
aagaatattaggatccagggcagttatgtcggtaacagacaggatgcgattgaggcactt
gatatcgcggcgtccggccgtgtcagggtcgtcttcgaggaaaagggtcttgagtctttg
aaagacgtttacgaggaccttgaggctggtaggattgctggccgagttgttctcaaggtt
tccgacgagtaa

DBGET integrated database retrieval system