KEGG   Cryptococcus gattii: CGB_G6170CHelp
Entry
CGB_G6170C        CDS       T02232                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cgi  Cryptococcus gattii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGB_G6170C
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CGB_G6170C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CGB_G6170C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(join(1184178..1184276,1184331..1184389,1184440..1184481,1184541..1184746,1184822..1184970,1185025..1185439,1185498..1185517,1185575..1185781))
Genome map
AA seq 398 aa AA seqDB search
MLSRVSPSLRQSLAAPLRASRMDTLSIQKAFTHSSTPRNHHITARPSSDKGLTSPTYNYK
FLNKPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISGLGWNVHYESHQNFLDIPY
NPLPSSSPVASHDGPSTHTTTAQGEKMVQRLPDPDIGNMKKPRLVSAVNEMVAKEVGDIA
EKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTETGNLHGCPVSFL
LGLDGCDVEPFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENKIKVFTMHHVDKYGIGK
VMELALQHINPSGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCL
VALDIMEVNPSLLDPRSVEKTVAAGCSLTRASLGETLS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctctctcgcgtctctccttctcttcgtcagtctcttgctgccccgctgagggcatcc
aggatggacactttgtctatccagaaagcgttcacccactcctcaacacctagaaatcat
catatcaccgctcgacctagcagtgataagggccttacctcgcccacttacaactataag
tttttgaacaagcctgctactgcgtctcttgtcggatgcccctttagcggtggacaaggt
cgagccggtgtcgatctcgccccaaacaagctcgtctctgctggcctcgtcgagcaaatt
tcaggcctcggctggaacgtccattacgaatcccatcaaaacttcctcgacattccttac
aatccccttccttcctcttcccccgtcgcctcccacgatgggccctctacgcatactacc
accgctcaaggggaaaagatggttcaaaggttgccggaccctgatatcggaaacatgaag
aaacctagattagttagtgcggtgaatgagatggtagccaaggaggttggggatattgcg
gagaagggatggctgcctgtgactttgggaggcgaccacagtttggcgatgggcactatt
gctggtactaagcgcaagtaccctaacgctggtgtgatctgggttgatgctcatgccgat
attaacaccccactgaccacggagactggcaacctccacggctgccccgtatctttcctc
ttgggtttagatggctgtgatgtcgagcctttcaacaagtggcttaaaccttgtctaaag
cctgaagatatcgtctacatcggtctccgagacattgatgacgccgaaaagaagattttg
aaggagaacaaaatcaaggttttcactatgcaccacgtcgacaagtacggcattggcaaa
gtcatggaacttgcacttcagcatatcaatcccagcggcgaccgaccccttcacctcagt
ttcgacgttgacgctcttgatcccacagttgctcctagcactggtacccctgttcgaggt
ggtctgactttccgcgaaggccattacattaccgaggtcgttgccgagaccgggtgtctc
gtcgcattggacatcatggaggtcaatcctagcctgcttgaccccaggtccgttgagaag
actgttgctgctggctgttccctcacgcgagcgtctttgggtgagactttgtcgtaa

DBGET integrated database retrieval system