KEGG   Cryptococcus gattii: CGB_G6620CHelp
Entry
CGB_G6620C        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cgi  Cryptococcus gattii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGB_G6620C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CGB_G6620C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(join(1315429..1315434,1315487..1315939,1316109..1316756))
Genome map
AA seq 368 aa AA seqDB search
MTKFAGEKLPTGSRYLPIILSCTLVYLASYFTLRSLAQKPTRTSLVTPILALGGLYHPAY
WRLSTAGALITLVAPLLSYDFVYRAHFLHPSQHISFARVGWVTETSARLLMRSTVPDQVD
VSYWPSHDSSAVSHVELSQSSLKTDFTSRLYIEDLQPGITYFYNSTAGHKGSFTTRRSKH
DQKQFNLLSTSCQKPNWPYNPLSHSLAISGLEHVDKIYSSPSWTPLLRSIPWLHMFDDHE
IINDYAPSSSALSDLFIQAIDPFINYQQAVNPPPISLTQPTYFRFEIGDVSFFVLDCRSW
RSTQPARPGANSTAGFGNRTMLGESQLTAVKEWAEEGTRDGKLLVLVSGVPITRNWSEGK
DEMDSWAG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatttgcgggggaaaagcttcccactgggtctcgatatcttccaatcattttg
agttgtactctggtttacctcgcatcttacttcacacttcgctctcttgctcaaaagccc
actcgaacgtcgcttgtcacgcccatcctagctcttggtggactttaccaccccgcgtat
tggcgtctttcgacggctggggctttgatcacattggtagctccgcttctgtcgtacgac
tttgtctaccgcgcccatttcctgcatccgtcacaacacatctccttcgctcgggttggc
tgggtaacagaaacgtcagccagactcttaatgcgatccactgtcccagatcaggtcgat
gtatcctattggccttcccacgatagcagcgctgtctcacatgtcgaactttcacagtcc
agtctcaaaaccgacttcacttctcgtctgtacatcgaagatctgcaaccaggcatcaca
tacttctacaactcgactgccggtcacaaaggttccttcaccactagacgatcaaaacat
gatcaaaagcaattcaaccttcttagtacaagctgccagaagcccaactggccctataat
cctttgtctcattcattagcaatcagtggtttagaacatgtcgataaaatctattctagc
ccatcttggaccccacttcttcgttcaattccctggttgcacatgtttgacgaccatgag
atcattaacgactatgccccttcctcttctgcactctccgacttgttcatacaagccatc
gatccattcataaactaccaacaagccgtcaatcctcctccgatcagtctcacacaaccg
acatacttccgctttgagataggcgatgtatcattcttcgtcttggactgccgatcatgg
cgctcaactcaaccagccaggcctggtgccaattcgacagctggctttggcaatagaacg
atgcttggagagtcacaacttacagcggtcaaagaatgggcagaggaagggacgagagat
ggaaaattattagtactcgtatcaggagtgccgatcactcggaattggtcggaagggaag
gatgagatggacagctgggctgggtag

DBGET integrated database retrieval system