KEGG   Cryptococcus gattii: CGB_H0630WHelp
Entry
CGB_H0630W        CDS       T02232                                 

Definition
enoyl-CoA hydratase
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cgi  Cryptococcus gattii
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGB_H0630W
   01212 Fatty acid metabolism
    CGB_H0630W
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CGB_H0630W
   00650 Butanoate metabolism
    CGB_H0630W
  Lipid metabolism
   00062 Fatty acid elongation
    CGB_H0630W
   00071 Fatty acid degradation
    CGB_H0630W
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CGB_H0630W
   00310 Lysine degradation
    CGB_H0630W
   00380 Tryptophan metabolism
    CGB_H0630W
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CGB_H0630W
Enzymes [BR:cgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CGB_H0630W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(177314..177611,177679..178098,178156..178239,178296..178345)
Genome map
AA seq 283 aa AA seqDB search
MFVRTLLRPSQTTYRFTIRSMSTSAEQLVIPSRSPSNNVAILTLNRPKALNALSTPLFNA
LNAELEKAETDDSVRAIVITGGDKVFAAGADIKEMKDKEFAEAYTTNFLGSWNQVASVRK
PIVGAVAGYALGGGCELAMLCDILIASPTAVFGQPEITLGIIPGMGGSQRLTSLIGKARA
MDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKVAESVSKFGKVAVQAGKEAVNGS
LDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKRKPSWSDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccgcactcttctcagaccttcccaaactacgtaccgattcaccatccgctcc
atgtccacctctgcagaacagctcgtcattccctctcgttctccttcaaacaacgtagcc
atcttgacccttaacaggccaaaggccctgaacgcgctgagcacacctttgttcaatgct
ctcaatgccgagcttgagaaggccgagacagatgacagtgtgagggccattgtcatcacc
ggtggtgacaaggtgttcgctgccggtgctgatatcaaggagatgaaggacaaagaattt
gccgaggcatacaccacaaacttccttggatcttggaaccaagttgcctctgtccgcaag
cccattgtcggtgctgttgctggctacgccctcggaggcggatgtgagctcgccatgctc
tgcgacattctcatcgcttcccccaccgccgtttttggtcaacccgagatcacactcggg
atcattcccggtatgggaggctcccaacgtcttacttcccttattgggaaggcgagggcg
atggatatggtcctcaccggtaggaagattgatgcagagacagctgagagatggggattg
gttagcagggttacgaaggaaggggagagcgtgactgaggaagcggtgaaggtggcggaa
agcgtgagcaagtttgggaaggtggctgtacaggctggtaaggaggctgttaatggatct
ctcgatcttcccctcgagcaaggtctcaggctcgaaaggaggttgttccagcaacttttt
gcgactaaggaccagaaggaaggtatggctgcctttgcagagaagaggaagccttcctgg
tctgacaagtaa

DBGET integrated database retrieval system