KEGG   Cryptococcus gattii: CGB_H1030CHelp
Entry
CGB_H1030C        CDS       T02232                                 

Definition
MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cgi  Cryptococcus gattii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CGB_H1030C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CGB_H1030C
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CGB_H1030C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(join(219932..220082,220161..220331,220377..220752,220821..220980,221041..221112,221162..221261,221327..221334,221429..221624,221687..221733))
Genome map
AA seq 426 aa AA seqDB search
MDNTPRHLFQTPNNVYILQQPWQFVKELGQGAYGCVSSARNSSTGETCAVKKVTNVFQKK
ILTKRCLRELRLLHHFRGHKNITCLYDMDIVFDPPGSGQFREVYLYEELMEADLHAIIRS
GQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFQPG
AVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAELLGGKPIFKGED
YVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPNASPLALDLLSK
LLTFDPAKRYGCEEALEHPYLAVWHDPADEPLCEVPFDFSFEEEDSVSGMRDLILEEVRS
FRYLVRQHSMPPIRRDSHDLPPAPPAPQHPGAGVGPAFHEKANCEGDMEEHPGSALEKQL
ERQKLS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggacaacactcctcggcaccttttccagacacccaacaacgtctacattcttcaacag
ccatggcagtttgtcaaggaactcgggcaaggagcgtacggctgtgtgtcatctgcgagg
aactctagtacgggagagacatgcgcagtgaagaaggtgacaaatgtgtttcaaaagaag
atcttgacaaagcggtgtctgagagaactgaggttactacatcatttcagagggcataaa
aatatcacctgcttgtacgacatggacattgtctttgaccctcctggatcaggacaattc
cgtgaagtctatttatacgaggagctgatggaagctgatttacatgccattattcgttcc
ggacagcctctttcggacgcacacttccaatcatttttataccaaactctctgtggtctc
aagtacattcactctgccaatgtccttcatcgggatctgaaacctgggaatcttctcgtg
aatgctgattgcgagctcaagatttgtgatttcggtttggcccgtggtttccagcctgga
gcagtgcaaacggatcaaggtcaagccgggtttatgactgaatatgtcgccacaagatgg
tatagagcccccgaaatcatgctttcatttgccaactatacttcaagtatcgatatgtgg
tctgttggatgtatcctggccgaacttcttggcggtaaacccatcttcaaaggtgaagat
tacgttgaccagctgaataaaatcctcaaccttcttggtacccctactgaagacactctc
cggagagttggttcccctagagcgcaggattacattaggagcctgcccattaagccgcgt
gtcaaatttgagacactgtatcctaacgcatctcccttggcgttggatttattgagcaag
ctgttgacatttgaccctgccaagagatacggctgtgaagaggccctagaacacccgtat
ctcgcggtatggcacgatcccgccgacgaaccactttgcgaagtcccatttgacttttct
tttgaagaagaagattccgtcagcgggatgagggatttgatcctcgaagaggttaggagt
ttccgatacctcgtaaggcaacactctatgcctcctataaggagagattctcatgatctc
cccccggctcctcctgcacctcaacatcctggcgctggcgttggccccgctttccacgaa
aaagcgaattgcgaaggcgatatggaagaacaccctggatccgcattggaaaaacagttg
gagaggcagaagttgtcatag

DBGET integrated database retrieval system