KEGG   Cryptococcus gattii: CGB_H1160WHelp
Entry
CGB_H1160W        CDS       T02232                                 

Definition
anthranilate synthase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cgi  Cryptococcus gattii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGB_H1160W
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGB_H1160W
Enzymes [BR:cgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CGB_H1160W
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CGB_H1160W
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CGB_H1160W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(250434..250559,250614..250784,250838..252799)
Genome map
AA seq 752 aa AA seqDB search
MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIERMFADGELERIVISPGPG
HPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAYAGEIKHGKTSLVQHDSIG
VFHSLPQFLSSTRYHSLSAQIQSVPSVLQVTSTTKESGVIMGVRHRTYTVEAVQYHPESC
MSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQSKAKTNGAPSLPTILNKIHAQRL
LDVEQAEKIPATTPANVSTSLSLYTSPPLINFRDRMVSTPHTAVMAEIKRASPSKGDIAP
TASAPEQALKYALAGASVISVLTEPTWFKGSVLDMLAVRNAVDSLPNRPAILRKDFVLSK
YMIDEARLYGADTVLLIVAMLAPQQLKELYDYSVSLGMEPLVEVNNPTELSLALEIGSKV
IGVNNRNLHDFNVDMSTTSRVNAALNGRDVVVCALSGISSHEDVEQYVKEGVKGVLVGEA
LMRATDTKAFLRSLIGLPPLEVVPKPKPLVKICGIRSADDAKLAISAGADLLGVILVPGT
KRCISTSTAREISALVQSARSQSSSKPLEPSLSSPWFTTQSALLSSRRKPLLVGVFQNQS
LSDILSAVDEIGLDLVQLHGDEPQAWAKFIPVPVIKVFRVSPEGIVRGGEIRRPGLNQAI
LLDAGGASGGGGEGKAFPWEHAKRLIQSGEVGSEGHVPLPVILAGGLTPENVGQAIEQAG
EGVWCVDVSSGVEGEGGKVKEKVEAFVKAVRG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactctactgatcgacaactacgactctttcacctggaacatttacgctgat
cttgcgtctgtcggcggtaatccctatgtcgtccgtaatgataagattacccttaaggag
attgagaggatgttcgctgatggcgagcttgaacgaatcgtgatatctcccggtcccgga
caccctaggacagactctggtgtctctagggatgtgattgcttggggaatgggcaagttg
cctatattaggtgtgtgtatgggtttggagtgtattgttgacttgctcggtggagagatt
gcttacgcaggtgaaatcaaacatggtaaaacctcgcttgtccagcacgattctatcggt
gtcttccacagcctcccacagttcctctcttctactcgataccattccctttccgctcaa
attcagtcggttccttcagtcttgcaagtcacttcgaccaccaaggaatctggtgtgatt
atgggtgtacggcacaggacatacaccgttgaagccgtgcagtaccatcctgagagttgt
atgagtgagggtggtcgaggattgatggccaatttcatccaaatgaagggcgggaaatgg
ggtggtgaaaatgcttggtgtggcgttcctgcggagggagaggaagaacagtccaaggcc
aagaccaatggcgctccaagcttgcctactattttgaataagattcacgcgcagagatta
ttggacgttgagcaagccgagaagattcccgctacaacccccgccaatgtctctacctct
ctttccctctacacttccccacctttgattaacttcagagaccgtatggtctctactccc
cacactgccgtcatggctgagattaagcgtgcctctccttccaagggcgatatcgcccct
accgcttcagctcccgagcaagcactcaaatacgcccttgctggtgcttcagtcatctca
gtactcacagagcctacgtggttcaaggggagcgtgcttgacatgctcgctgtgcgaaac
gctgttgacagtctccccaatcgtcctgccatcttgcgaaaagacttcgttttatccaaa
tacatgattgatgaagctagactgtatggtgccgataccgtgcttctcatcgtcgccatg
ttggcgcctcagcagctcaaggaattgtacgattactctgtgtcacttggcatggagccc
ctcgtcgaggtcaacaaccctactgagctctcactcgcccttgaaattggttccaaggtc
atcggcgtgaacaaccgtaacctgcatgactttaatgttgacatgtccaccacttctcgg
gttaatgccgctctcaacggacgggacgttgttgtctgcgctttgagcggtatttcaagc
cacgaagatgttgagcagtatgtcaaggaaggcgtcaagggtgtgcttgttggtgaggct
ttgatgcgcgcgaccgataccaaggctttcctccgatcgcttattggcttaccgcctctt
gaggtcgttcccaagcccaagccgctcgtcaagatttgtggtatccgctctgcagacgat
gccaagcttgcaatcagcgccggtgccgatcttcttggtgtaatccttgtccctggtaca
aaacgctgcatctctacttctaccgcccgcgaaatttccgctcttgtgcaatctgcccga
tctcaatcttcttccaagccattagaaccttctctttcctccccttggttcaccacccaa
tccgccctgctctcatcccggcgcaaaccccttttagtcggtgtcttccaaaatcaatct
ctctctgacatcctttcagccgtcgacgagattggcctcgaccttgttcaattacacggt
gatgaaccccaagcctgggccaagttcatccccgtgcctgtgatcaaggtgttccgagtc
tcacccgaaggaatcgttagaggtggagagattaggcgaccaggtttaaaccaagcgatc
ttgctcgatgcgggtggtgcgtctggtggtggtggggaaggaaaagcattcccttgggaa
cacgcgaagcggctcatccagtccggcgaggtgggatctgaaggccatgtgcccctccct
gtcattctcgcgggcgggttgacgcccgagaatgtgggccaggcgattgaacaagctggt
gaaggcgtttggtgtgtggatgtcagcagcggggtcgaaggagagggaggaaaggtcaag
gagaaggttgaggcgttcgtgaaggccgtaaggggctaa

DBGET integrated database retrieval system