KEGG   Cryptococcus gattii: CGB_H1240WHelp
Entry
CGB_H1240W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CGB_H1240W
Peptidases [BR:cgi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CGB_H1240W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(269542..269823,269864..269971,270027..270101,270161..270288,270340..270485,270540..270859,270912..271253,271336..272195,272272..272385,272450..273029,273094..273111)
Genome map
AA seq 990 aa AA seqDB search
MVRTPQRPCPDWDWVGTEVQTPDKITLKHRRRAAGLVGGVACSRDLTEHAEKSVSGNGET
KVNGKGNWKKKGSGCRAKSCKSNYMCYNNLGTEKLLEPDAKSEFVISNLGEVPEERNGPA
GLKNLGATCYANAFLQLWFHNIPFRNAVYACVTTETTPLYQLALIFAKLEYSEKSVIDPM
GLIDALRLNAGDQQDAAEFSKLFMSLIASEFSKHPDPKLKTVVKDQFEGTMQYITQCECG
YESISETTFLELELSLEDNTTLQSRLDEFTHPEILDGDNKYSCPSCLSKRRATRRQLPVT
LPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEAVLGNSVYELRGVISHQGTSAYHGHFI
CETYDEIDDIWHICNDELVQPKPARPHKRTKVDKPATDKDRLQSSKDAYMLVYKRRDGHV
PPQSPPAIVMEKVKEENRGLREELNKGVVRKEVLEGEWEHLKGAKMDTDYIVPRDALAAW
IQSPSFPDLNTPFDYSSILCAHSQVDPFKSSDTRTISAVAHDKLSSYITLPEIDVCPVCV
EEGFATRLSKAEQQSALETFDELNTVAEVEEAGEEERWCLPKTWLAHWRSGKLTPKTLPT
HPSYTLFCPHDAPLPSTSIPPFTLITSSAFSLLRSIFGPFPSFHPGRPPCPECSNDASQD
AESLIQWKTDVKLDKSIKRHLDPRPPAFGLDYYVLPKEFIKKWETYMKTPGGQKPELDMG
LGRGECEHGLLDWDPQIEKPRVISEVGWRMLCQKYGEKEPIKVQFGANPPEGKKVNITSF
TPSVCNPCRIARLSSYDELVIPVVFASAPPLSSSASYNTPTSTGRAIGPKLGSGSNRNTS
RTLRSRLKTLYIQAARQSTIKDLKVSILSQTGITPLLQKIYYKPRTQSQEQGQYSGEEKE
DETELDNDLRISEFGYLKGEELILVEVKEEGDLDDDDVVNGGSGGKGRNGRNEGFGGTGL
LARIACPDCTYENDGTAECCEMCMRPFKNN
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggtaagaacccctcaaagaccctgtcccgactgggactgggtcggtacagaggtccaa
acgccagacaagatcactctcaaacatcgacggcgtgcagctgggcttgttggaggggtg
gcttgttctcgtgaccttacagagcatgcagaaaagtccgtcagtggcaatggagagacg
aaagtaaatggaaaaggaaattggaagaagaagggatcaggatgtagagcgaaaagctgt
aaatcgaattacatgtgttacaacaatctcggaactgaaaagcttctggaacctgacgca
aaatcggaattcgtcatttcgaacctgggagaagtcccagaagagcgtaatggacctgct
ggcctaaagaacctaggggcaacgtgctatgcaaacgccttcttgcaattgtggttccac
aacatacctttccgtaatgcagtctatgcttgcgtgaccacagagaccacaccactctac
caattggctcttatcttcgccaagcttgaatatagcgaaaagagtgtaatagatcccatg
ggactgatagatgctctgcgactgaatgcgggtgatcagcaagatgcagcagagttctca
aaactgttcatgtcattgatcgcatcggaattctcgaaacatcccgacccgaaactcaag
acggtagtaaaagatcagtttgaagggacaatgcaatacattacgcaatgtgaatgcggt
tatgagagcatttctgagaccacctttctcgagcttgaactctctctggaagacaacaca
acccttcagtcccggctagacgaattcacacatcccgaaatcctcgatggggataacaag
tactcctgtccctcctgcctctctaaacgccgtgcaacccgtcgccagctacctgtcacc
cttcctcccgttatccacttctctcttctaaggtttgtgtttgacctcaaaagcatgtcg
agaaaaaagagtaaagcgtcgataaagtatccgaaggaggcggtgcttgggaattcggta
tatgagttaaggggggttatatctcatcaagggacaagcgcatatcacggccatttcatt
tgcgaaacctacgatgaaatcgatgatatatggcatatctgtaacgacgagttggttcag
cctaaacctgcccgaccccacaagagaaccaaggttgacaaacctgccactgacaaggac
aggctacaatcgtccaaagacgcatatatgctcgtttacaagcgacgggacggccatgtg
cctccccaatccccgccagcgattgtcatggaaaaggttaaggaggagaatagaggattg
agggaagagctgaataagggcgtggtgaggaaagaggttttggaaggtgaatgggagcat
ttaaaaggggcgaagatggatacagattacatcgttcctcgtgatgctctcgccgcatgg
atccaatctccctccttcccagatctcaacaccccattcgactactcgtccattctctgt
gcccattcacaagtggatccttttaaatcttccgatacacgtacgatatccgccgtagct
catgacaagctttcatcatatattactcttcccgaaattgacgtctgcccagtatgtgtt
gaggaaggttttgcaaccaggctgagtaaggcggagcagcagtcggcgcttgagacgttt
gacgaactgaacaccgtagccgaagtagaggaagcgggcgaagaggaacggtggtgtcta
cccaaaacatggctcgcccattggcgatccggtaaactcactcccaaaaccttgcctaca
cacccttcctacaccctcttctgtcctcatgacgcgcctttaccctcaacttccatcccg
cccttcactctcataacttcctctgctttctccctcctccgctccatctttgggcccttc
ccttccttccacccggggagacctccctgcccggagtgttccaatgacgcgagtcaagat
gcagaatcgttgatacaatggaaaacggatgtgaaactcgataaatctatcaaacggcat
cttgacccgcggccgcctgcttttgggctggattattatgtacttccaaaagagtttatt
aagaaatgggagacgtatatgaagaccccaggggggcagaagccagagttggatatgggt
ttgggtcgaggggaatgtgagcatggattgttggattgggatccgcagatagagaagccg
agagtcattagtgaggttggatggaggatgctatgtcaaaaatatggcgagaaagagcca
atcaaagtgcaatttggtgctaatcctccagaaggaaagaaagtgaacattacctctttc
actcctagtgtctgcaacccatgccggatcgccagattatcatcgtacgacgaactcgtg
atacccgtcgtctttgcctctgcgccgcccttgtcttcctccgcatcttataatactccc
acctctacaggcagagccattggaccaaagctaggatcagggtcaaaccgcaacacgtca
agaaccctacgttcacggcttaaaactctatacatccaggctgccaggcaaagcacgata
aaggatctcaaagtgtccattctctcccaaacaggaatcaccccgctactccagaagatt
tattacaaacctcgaacacaatcccaagagcaagggcaatattcgggagaagagaaagaa
gacgaaacagagctggataatgatctgaggatcagcgagttcgggtatttgaaaggagag
gagttgatattggtggaagtaaaagaagaaggagatttggatgatgatgatgttgtaaat
ggaggtagtggagggaaggggaggaatgggagaaatgaaggattcggagggacgggattg
ttggcaagaattgcatgcccggattgtacttatgagaatgatgggacagccgaatgctgt
gagatgtgcatgagaccatttaaaaataattga

DBGET integrated database retrieval system