KEGG   Cryptococcus gattii: CGB_H1770WHelp
Entry
CGB_H1770W        CDS       T02232                                 

Definition
protein kinase
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
cgi  Cryptococcus gattii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CGB_H1770W
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CGB_H1770W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CGB_H1770W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(406707..406853,406891..406952,407033..407178,407439..407508,407660..408273,408316..409229,409279..410547,410581..410703,410753..411059,411109..411199,411281..411423,411478..411971,412032..412055)
Genome map
AA seq 1467 aa AA seqDB search
MSSSPRGRRAPAPAALDLGAGTDWSKYPALGLGLGTAHGPGNRRVVTEPSQSQRTSRPLP
HPPGQPRHEAIHACPTSNLASAPYSAQLSSTAQPHPADIDRRNLVGVGELSTPRTPGSDK
LAKEPRGTSVRLYPPSFARECAKTPPNSASSRHSTSHDILKQFAVKDFSHLPPSPSSASI
NQFLRSSGSTQNISSGTPPGSASASGAYFSSKGVQREDSQKSQKHQQRTTPKPKELDPSV
DEALRKLDGLTSTPGKNKARSKSSGGPSAASSRPGTPVAVAIPETKSSRSESKIPLKPSI
GSFKDTTGSPLNNWIDLTEDIPAIPIPRARIPPHPNRESSSSASATATTMSSADLPEGME
KSVPPVPPLPQVYVNKKQQGIPPAVQSGGVQPPSYVSMHELSPEPLPSSPSKSTSPLTTA
TTAPVPVPPKMHKKWSFSSALNLKSAASPVDEMALSQSPQTPWSEIHRGELFSPNVHVQG
QGQQGQGQGQGQEPRGDSGPRQGATPLAPPPPPSSASSKASSSNVNKRLTPSSIPFFRRS
SSSSFHKTNQSVIVPETPKHVDKAITATTTATAIPSSQSQSRKSVLGMHFPSMLRGSSSK
RGLAQQATQQATQQATQQTGQSQVPVKEKEEVKAASAPSATSGWTGRKRGKTLSISGDLP
KPFPGLKHQSSAEISFGTRGSAVSNGSDATISSSNTYDRLPAIKGSPARPPPPDGPRYSN
SPRNLPSATPTKIPRMAQRPAPSPATVTAHSGMPPPPFPTAKKFSNTVSGAGGGGSGSGS
GGGGGPAVSEFGQVDGIIPTTPRLTTSGAHRAHLLAPMSARHDTRRVNNNNTNRTFGPPV
RKDTSYTTGVPPSRRQLPQPPTSTTTTVTNMTLSASAKRASREFKKKRESKDPQDGGWSS
SGKNSPVKPSKSMHSSMVVPSSSRLPSSSSAGAPGSNYRSRLSLADDSSSSMSPADDDEA
SGDAEMEAYIKRRRERAAVNKKDNLSDVTEFPRDITPVEQPLSQRAFITNNLAKMSDAER
KEVLDFDHIYYSPSPGTIRRPSQPGGANYNHGYDDERGDYLVVEGDHLCYRYEVVVQCRD
HKTGKSVAVKIIRNKKRFHAQALVEVKILQQLVEWDPEDKHFMVRMTDSFSFRNHLCIVT
ELLSINLYELIKANHFAGFSTVLIRRFTTQMLGSLQLMRSHRIVHCDLKPENILLCHPAK
SAIKVIDFGSSCLETEKVYTYIQSRFYRSPEVILGMNYAMAIDMWSLGCILAELYTGVPI
FPGENEHEQLACIMEVLGVPDRYLIEKASRRKNFFDATGAPRPFVNAKGRRRRPGSKTLA
GVLKCDDELFVDFIARCLTWDPDKRLKPQPAMRHPWILAGRKRYVPTPSRDEKRAASERS
SRLFGSSHTSTRISSKNLSELSSPSIKDNDKSKLLISSPVPLAPARHAYHSSIASTSRIG
QAMSSSRLAHQTSARSGSFNTSELSIG
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgtccccccgtggccgcagagcaccggcgcccgccgcattggatctcggtgca
ggcacagactggagcaagtatcccgccctcggtctcggcctgggcacagcgcacgggcct
ggaaaccgacgggtggtcaccgagccttcccagtcccagcgcacgtcccgccccctgcca
catccgccaggccagccgcgccacgaagccattcacgcctgtcccacctccaatctcgcg
tcggcgccctactctgcccaactttccagcaccgcgcagccgcaccctgcagacattgac
cgtcggaacttggtcggcgtcggcgagctttccactccccgaacgcctggttccgacaaa
ctcgccaaagagccccgtggtacctcagttagactctatcctccctccttcgcccgggag
tgcgcaaaaacgccgcccaactcggcatcatctcgccacagcacttcccatgacatcctc
aagcaatttgccgtcaaagacttttcacacctcccacccagtccatcctctgcctccatc
aatcagttcctccgcagtagtggatctacccaaaatatctcttcgggaacgccgcccggc
agcgcgtccgcatcaggcgcgtacttttcatcaaaaggcgttcaacgtgaagactctcaa
aaatctcaaaagcatcagcagaggacaacaccgaaaccgaaagagctggatccgagtgtg
gacgaggcgttgagaaagcttgatgggcttaccagcacgcctgggaaaaacaaggcaagg
agcaaatcatcgggcggtccctctgccgccagttcgcggcctggtaccccggtagcggta
gccatacctgaaaccaagagcagcaggtcagagagtaaaatccctttgaaaccgagtatt
ggatcattcaaggacacgacgggttctccgcttaataactggattgacttgactgaagat
atcccggcgatacctatcccgcgcgcacggatcccaccgcatccgaaccgcgagtcttct
tcctctgcgagcgcaaccgcgacgaccatgtcttccgccgatttgccggaagggatggag
aagagtgttccaccggtaccgccacttccccaggtgtacgtcaacaagaaacagcagggt
atcccaccggccgtgcagtctgggggggtgcaaccgcccagctacgtgtcgatgcatgag
ctttcgcccgagcctctcccatcttcaccatcaaagtctacatcgcctttgactaccgcg
acgactgcacctgtgccagtcccaccaaagatgcacaagaaatggtcattctcttcggcg
ctcaacctcaaatcggcggcatcaccggtagacgagatggcgttatcgcaaagtccgcaa
acaccatggtctgaaattcatcgaggtgaattgttttcccccaacgttcatgttcagggg
caagggcaacaagggcaagggcaagggcaagggcaagagcccagaggcgattccggtccg
cggcagggtgcaacccctcttgccccgccaccaccgccgtcgtctgcttcatcaaaggct
tcttcgtccaacgtcaacaagcgcctgacaccttcttcaatcccctttttccgccgctcg
tcatcctcttcattccacaagacgaatcaatcggttatagtgcccgagacgcccaagcac
gttgacaaggcgatcacggcgacgaccacggccacggccataccgagctcacagtcacaa
tctcgcaagtcggtgctggggatgcatttcccgtccatgcttcgaggaagttcatcgaaa
cggggtctggcgcaacaagctactcagcaagctactcagcaagctactcagcaaactggt
cagtcccaagttcctgtaaaggaaaaagaagaggtcaaggctgcaagtgcaccgagcgcg
acgtcgggatggactggtaggaaacgtggaaagaccctctccatatctggagatctccca
aaaccgttcccaggcctcaaacaccagtcttcagcagagatttcttttggaacccgtggt
tcagcggtgtccaacggtagcgatgcgactatcagcagcagcaatacatatgatcgtttg
cctgctataaagggctcacctgctcgacctccccctcccgatggtccgaggtactccaac
tcgccgaggaacctgccttctgccacgcctaccaagattcctcgaatggcccaacgtccc
gctccgtcgccagcgactgtcaccgcccacagcggtatgcctcctccgcctttccctact
gccaagaaattcagcaacacggtatctggcgcaggcggcggcggcagcggcagcggcagc
ggcggtggcggtggccctgctgtatcagaatttgggcaggtcgacggtattataccaaca
acgccccgactgactacttcaggtgctcaccgagcccatttgcttgctcccatgtcagct
cgacacgacacgcgtcgcgtgaataataataatactaatcgaacctttggtccccccgta
cgtaaagacacatcatataccaccggtgttccgccttcgagaaggcagctgcctcaaccg
cccacatcaacgacgacgactgtcaccaacatgacgctttcggctagcgccaagcgcgca
agtcgagagttcaagaagaagcgcgagtccaaggatccacaggatggggggtggtcctct
tctgggaaaaactcgcctgtcaagccatcaaaatctatgcattcaagcatggtcgtgccg
agctcttcccgtttaccctcttcgtcctctgctggtgctcctggttcgaattaccggagc
aggttatctttggccgacgactcgtcgtcctcgatgagtcctgcagatgatgatgaagct
agtggagatgcagagatggaagcttatattaagagacgacgtgagcgcgcagcagtgaat
aaaaaggataacttgtcggacgtgaccgagtttccaagggatatcacccctgtcgagcag
cctctttcccagcgcgcgttcatcaccaataaccttgcaaagatgtctgatgcagaaagg
aaagaggtgctcgatttcgaccatatctactacagtccgtccccaggtactatccgtcga
ccctcccagccaggaggagcaaactataatcacggatacgatgatgagcgaggggattat
ctcgtggtggagggtgatcatctttgttataggtacgaagtggtcgttcaatgtcgggac
cataaaacgggcaagtcggtggcagtcaagatcattagaaataagaagcggttccatgct
caagcattggtggaagtcaagatcttgcagcagctggttgaatgggaccccgaagacaaa
catttcatggtccgtatgactgacagcttttctttccgcaaccatctctgtatcgtcaca
gagctcttgagcatcaacctttacgagcttatcaaagcaaaccactttgctggcttttca
acagtcctcatcaggaggtttaccacccagatgctgggttccctgcagttgatgagatca
cacaggatcgttcactgtgatttgaagcccgaaaatattttgctttgtcaccccgcgaag
agcgcgatcaaggtgattgattttggaagcagttgcttggagacggagaaggtttacact
tatattcaatcccgcttctatcgaagcccagaagttattctcggcatgaattatgctatg
gcgatcgacatgtggtctttaggctgcattcttgctgagctctatacgggtgttcccatt
ttccccggagaaaacgaacacgaacagctggcttgtatcatggaggtcctcggtgtgccc
gatcgctatttgattgagaaggcgtcacgacgtaagaacttcttcgacgctaccggtgcg
cctcgtccgttcgtcaatgccaagggtcgacgacgacgtcctggatccaagaccctggcc
ggcgttctcaaatgcgatgacgagcttttcgtcgatttcattgcccgctgtctcacttgg
gatcccgataagcgcctcaaacctcaaccggctatgcgtcatccttggatcctggcagga
cgtaagcgttacgtcccaacacctagtcgcgacgaaaaacgtgccgcttctgagcgatct
tcacgattgttcgggagctcacatacatcgacacggatcagttcgaaaaatctctcagaa
ttatcatcccctagcataaaagacaacgataagtcaaaactattgatttcctcgccggtg
cctttggcgcctgcaagacacgcatatcactcctcgatcgcttcaacatcaaggattggc
caggccatgagctcttcaaggcttgctcaccaaacttccgcgagaagtggctcattcaat
acctcagaacttagcattggctaa

DBGET integrated database retrieval system