KEGG   Cryptococcus gattii: CGB_H2110WHelp
Entry
CGB_H2110W        CDS       T02232                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cgi  Cryptococcus gattii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGB_H2110W
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CGB_H2110W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(470610..470905,470961..471015,471057..471738,471807..471880,471935..472321,472396..472461)
Genome map
AA seq 519 aa AA seqDB search
MVVTPTRPPVEPAGPPLSPLALASTVLASSSDSYSSSQSGSRSLQRHRRTSGSSFSKLSE
FSLDPPLLDKKDQYAASPDQIDENGVNDVRHVALSVDASEWRHPVFKQKVLAILRRLHVP
RWSSPLLTPTNIHLQKVSGAMTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPPPL
TPDQYPHTLLFRVYGPSSDALISRSEELRILHVLSTQYGIGPRIFGTFTNGRVEEFFPSR
ALTAQELRDPIISRGIARRMRELHSVDLRLLGYEQGRATEPALWICLKEWSEAAEDVISS
LTSLGGTLEAWVERLSLHRIQEEIAIYRNFVESQSGKGNGVVFAHNDTHYGNLLRLDVEL
PPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRADYHHPTLSHSLIPHFPYPTPNQRE
DFYRAYLSVEVDGRNGEEVVGKRKDVPADKVAALEREVRIWSPGCSINWALWGLVQAEEQ
ICALVTKKEGYVPEFDYLAYATERLEMFRDEAKKLGVPL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcactcccacccgccctcccgtcgagccagcaggccctcctctctcccccctg
gcactcgcctccactgtccttgcaagcagctcagactcctactcttcctcgcaatctggg
tcaaggtcgctacaaaggcatagaaggacatcaggaagcagcttttcaaagttatccgag
ttcagcttggaccctccccttctcgacaaaaaggatcagtacgctgcctcgcctgaccag
attgacgaaaacggtgtcaacgacgttcggcatgttgcgctgagtgtggatgccagcgaa
tggcggcatccagttttcaagcaaaaagtcctggccatcttacgacgcctccacgttccg
agatggtcctctcctcttttaacgcccaccaacatccaccttcaaaaagtgtcgggcgcc
atgacaaatgccgtcttttttgtttctttcaatcccgctccgaacccaacttcgccttcg
gaatcgcccctgctaacccctaccattcctccatccgacccatcccaccctccaccactc
acccccgaccagtatccgcacactcttctcttcagagtctatggcccctcctcggatgca
ctcatctcccgatcggaagaattacgtatactccacgttcttagtactcaatatggcatt
ggccccagaatttttggcacttttaccaatggccgagtcgaggaattcttcccatcacgc
gctttgaccgctcaagaattacgcgaccctattatttctcgtggcattgctcggcggatg
cgcgaacttcattcggtggacttgcgtcttttgggatacgaacaaggtcgtgctacggag
ccagcattatggatatgcctcaaagaatggtccgaagcagccgaggatgttatcagctct
ttaacatctctgggcgggacattggaagcgtgggtagagcgtttatctttacatcgtatc
caggaagaaattgcaatctacaggaactttgtagaatcgcaaagtggaaaaggtaacggc
gtggtgtttgctcacaacgacacacactatggaaatctgttgcgcctcgatgttgagctt
ccgcccaacacgcctgaacattgtcgttatattgtgattgactttgagtatgcctctccc
aacccgcgtgggtacgatattgccaaccatttccacgaatggcgagcagactaccatcac
ccgactctctctcattccctcattcctcatttcccctaccctacacctaatcagcgtgaa
gatttttatcgagcatacttatcggtcgaagtggatggaaggaatggcgaagaagtggta
ggtaaacgcaaggatgttccagcagacaaggtcgctgctcttgaacgtgaagtaaggatt
tggagtccggggtgcagtataaactgggcgttatggggtttggttcaagctgaagaacag
atctgtgccttggtcacgaaaaaggaagggtatgtcccagaattcgattatcttgcgtac
gccactgagcgacttgaaatgttccgggatgaagccaagaagcttggagttccgttatag

DBGET integrated database retrieval system