KEGG   Cryptococcus gattii: CGB_H2140WHelp
Entry
CGB_H2140W        CDS       T02232                                 

Definition
cyclin-dependent protein kinase regulator
Orthology
K06634  
cyclin H
Organism
cgi  Cryptococcus gattii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CGB_H2140W
  Replication and repair
   03420 Nucleotide excision repair
    CGB_H2140W
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CGB_H2140W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(476681..476875,476957..477183,477234..477426,477482..477903,477954..478260)
Genome map
AA seq 447 aa AA seqDB search
MVLSGQATPSEAGPSKPSLTPGPSAYHESSQFRHWRFSPSTLDRIRSELNTKSVEVARRN
TELEKEAQKSLGHDIADPPPAATYLTVNDELLLLRFYCSQVSRICREGFGLPEVVESTAI
SYVKRFYLKNSVMEWHPKIIMPTCLYLAAKTTNFPIPADQFVSKIPKLTSEDVLEKEFLV
AQSLSFEFWVHGADKALRGWTLDMQDQPNPPLEAIQKAIAPAFTHLSTSYLSDAEFIFTP
SQISLACLRMADKKLVEGFLEGRYAAHAAAIASNSVDGAEESKAGTPVQGPAPLYGMEKS
RLLEILEQIEAIIQTAAVGLDVKKVKEVDKRLRQCTNPEKIPGTALYIKRKQEKEATEAA
AKAAKTLKAQSSAADSDVFFGGSLPLSNAQSKSRVPLSPRVNLNGNQKAGGAEVEMSDTG
MGIQGESGGLLMGGKGLKDVGLPLSKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtcctatcaggacaagctacaccctcagaggccggtccatcgaagccctctctgact
ccaggcccttccgcgtaccacgaatcttcacagttccgtcattggcgcttttccccgtcg
acgttggatagaatacggtcggagttgaataccaaatcggtcgaagtggctaggaggaat
acggagctagagaaggaagctcaaaaatcactagggcacgacattgccgacccaccacca
gccgcaacttatcttacagtcaacgatgaacttttgcttctccgcttttattgttcacaa
gtatctaggatctgccgcgaaggctttggtcttccagaggtggtagaatcaacagcaatc
agttatgttaaaaggttctacctcaagaacagtgtcatggaatggcatcctaagatcatc
atgccaacatgcctttatctagccgccaaaaccaccaattttcccattcccgcggaccaa
ttcgtgtccaagatcccaaagctcacttcggaagatgtcttggagaaagagtttctggtc
gctcaaagcctgtccttcgagttttgggtgcatggagcggataaggctttgagaggttgg
acactggatatgcaagatcaaccgaatccgccactagaggcaattcaaaaggccatcgca
ccagcttttacacatctctccacatcctacctttcagatgccgaatttatttttacaccg
tcgcaaatatccttagcttgcttgagaatggcggacaaaaaactggttgaaggcttcttg
gaagggcgatatgctgctcatgcggctgcgatcgcttcaaattcagtggatggggctgaa
gaaagcaaagctgggacgccagtccaagggcccgcacccctatatggtatggaaaaatcc
aggctcttggagatccttgaacaaattgaagccataatccagacagctgccgtcggattg
gatgtcaagaaggtgaaggaggttgataagcgattgagacaatgtacgaaccccgaaaag
atcccgggaactgccttatatatcaagcgaaagcaagagaaagaggcgaccgaggcagca
gctaaagcagctaaaacactcaaggctcagtcttccgccgcggatagcgacgtgttcttc
ggtggttctcttccactatccaacgctcaaagcaaatcaagggtccctttgtccccccga
gtcaacctcaacggcaatcagaaagctggaggcgctgaagtggaaatgagcgatactggg
atgggtatccagggggaaagtggaggactgttaatgggagggaaaggattgaaggatgtg
ggcctacctttatcgaaggattaa

DBGET integrated database retrieval system