KEGG   Cryptococcus gattii: CGB_H3440WHelp
Entry
CGB_H3440W        CDS       T02232                                 

Definition
uricase (Urate oxidase)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cgi  Cryptococcus gattii
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGB_H3440W
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CGB_H3440W
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CGB_H3440W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(750491..750530,750583..750657,750713..750784,750849..750866,750933..751069,751124..751259,751317..751379,751435..751711,751767..751887)
Genome map
AA seq 312 aa AA seqDB search
MSQQPGYLSAARYGKDLVKVARVVRDGEQHHIVEYTLRVLLEGEIETSYTKADNSCVVAT
DTVKNTCNIFAKTSPYVLDAPVFALHLGLHFVTKYKHIHKCFVDIVGLKWSRISVDGKPH
KWSFVRDGDEKAIVECAVVGSAGSESATADLKIGIKDLLVLKTSGSAFENFYRDENTTLA
DVADRIFSTSVSLQCSISLPPNTPLTIDNLGSIAKELDFPKMKELILKDVLDTFATDESA
SVQATLYLTLQKILTSCPAVKDASMQLPNKHYIPINLSVFGLDNKLGYEGGAEVFYPAAD
PSGYITATVTRK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcagcctggctacctctccgctgctcgttacggtaaggaccttgttaaggtc
gctcgggttgtccgtgatggtgagcaacaccatatcgttgagtacactctccgagtcctt
cttgagggagagattgagacctcttacaccaaagccgacaactcctgcgttgttgctact
gacactgtaaagaacacttgcaacatcttcgccaaaacctctccttatgttcttgatgcc
cctgtctttgccctccatcttggtttacactttgtgaccaaatacaagcacatccacaag
tgttttgtggatattgttggccttaagtggagccgtatctcagtcgacggcaagcctcac
aaatggtctttcgtgcgagacggtgacgaaaaggcgattgttgaatgtgccgtggttggt
agcgccggctccgaatctgccaccgcggacctgaagattggtatcaaggatcttcttgtt
ttgaagacgagcggatcagctttcgagaacttctaccgagatgagaacaccactcttgct
gatgttgccgaccgtattttctcaacgtctgtctctctccaatgttcgatttcccttcct
cctaacacccctctcaccatcgacaacctcgggtctattgcgaaggaactcgatttccct
aagatgaaggagctcatcctcaaggatgtcctcgacacttttgctaccgacgaaagcgct
agtgtccaagctactctttacctcaccctccagaagattttaacttcatgtcctgccgtc
aaggacgcatctatgcagttgcccaacaagcactacatacctatcaaccttagtgttttt
ggcctggacaacaagttgggttacgaaggtggtgccgaagtcttctatcctgctgccgat
cccagtggttacatcacggccactgtcaccaggaagtaa

DBGET integrated database retrieval system