KEGG   Cryptococcus gattii: CGB_H4650CHelp
Entry
CGB_H4650C        CDS       T02232                                 

Definition
dual-specificity kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CGB_H4650C
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CGB_H4650C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(join(1008739..1010067,1010124..1010257,1010313..1010548,1010604..1010846,1010893..1011152,1011201..1011554,1011595..1011786))
Genome map
AA seq 915 aa AA seqDB search
MPPPRTAPSRSDTGSANDRRSSSAVSNREEEFRDIRGLADLRAVVNALPNGRRADPDAAG
KYLSPLKCLTSSLSETYTLCNPSFRYVTSDNPRRVLTKPSKPVHNDGADNEDWDYILYVN
DVLGGEDGRDRYLILDVLGQGTFGQVVKCQNMRTHDLVAVKVVKNKPAYLQQSKMEVAIL
ELLNTQHDPHDRHHILRMLDSFTHKHHLCLVFECLSSNLYELIKQNQFKGLSTQLVKVFT
QQLLDCLSVLKDARLIHCDLKPENILLKSLQSPQIKVIDFGSACHEMQTVYTYIQSRFYR
SPEVLLGLPYSTSIDMWSLGCIVVELFLGLPLFPGTSEYNQISRIVDMLGNPPSHLLEVG
KQTHEFFNIAPDAYGRNTYKLKPMQQYSMEHRTDEQPSKQYFKQTKLKDVIMEYPYAKRN
VKQNDIDKEMATRRSFVDFAEGLLNMDPIKRWSPQQALKHPFITGEKWTGPWQPDTTTTP
KKPVVPSSEPSASNSNAPANSISTPSKKYGGLVQSPPSSRSQRIYSDAAAYNQQLAQHQS
YTAQVQAQQNAQRVGPFSPGYNMAQAQAGGHAQAAGGSGGGSGYGHHRVVSQQIPSAASR
HHHAQQRQPSGQWNQQIAPPSSAGFQQRGPSLNNSASHASLRQPPSNVPIISNPPPNSYY
PASRHRANTINQMDAIPPALARLVHFGAQDPNGSRNSLTPVLNRDDAIREWERRQQGGHS
KQSSLHNASYPQLEYLQEQAELAAMQGQNWMVPGPYPPHPGHGHSHRSSFGEQSQSHGHR
TNPSGQYQMQPHIGISPPSGNDYRPRPTSEYDPPSSTASARGYGLPTYPPLAATTSHPPG
GSASGAVGVGQGVFDAFDGRDGGMGMLYTPLQPNQAYGYQGHAGQHGQGHGSRASYSGPY
SSSNPFANQPNSPRY
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgccacctccccggactgcaccttcgcgttccgatactgggtctgccaacgacaggaga
agttcgagtgcggttagcaatagggaagaagaatttagagatatcagaggactggctgac
ttgcgcgccgttgtcaatgcgcttcctaatggacgtcgagcggatcctgatgcggcaggg
aaatatttgagccctctcaaatgcctcacatcatctctctccgaaacgtacaccctctgc
aacccttccttccgttatgtcacgtctgacaacccccgtcgtgttcttactaaaccaagt
aaaccggtgcataacgacggcgcagataatgaggattgggattacatcctgtatgtgaac
gatgtgctcggtggggaagatgggagagatcggtacttgatccttgatgtgttgggacag
ggtacgtttgggcaggttgttaagtgtcagaatatgaggacgcacgatttggtagcggtt
aaggtagtcaaaaataaacctgcatatctgcaacagagtaagatggaagtggctatactt
gagctactgaatacccaacacgatccacatgaccgacatcacattctccgtatgcttgat
tcatttacccacaagcaccacctctgcctggtgtttgaatgtctttcgtcgaacctgtac
gaacttatcaaacaaaatcaattcaagggattaagtacccaattggtcaaggtgtttact
cagcaattgttggattgtctgtcggtgttaaaggatgcgagattgatccactgtgatttg
aaaccggaaaacattctgctcaaatcgctacaatctccacaaatcaaagtaattgacttt
ggatcagcatgccatgaaatgcaaactgtttacacgtatatccaatcccgattttatcgt
tcgcctgaagtcctgctgggtcttccgtactcaaccagcatcgatatgtggtctctggga
tgtatcgtggtagaattgtttttagggttgccgctgttccctggaacgagcgagtataat
caaatcagtaggattgtggatatgcttggaaatccaccaagccaccttctcgaagtcggt
aaacaaacacacgaattcttcaatatcgcccccgacgcctatggtcgaaacacctacaaa
ctcaaacccatgcaacaatactctatggagcataggacagatgagcagccgtccaaacaa
tatttcaagcagaccaagttgaaggatgtgattatggaatatccttatgcgaaaaggaat
gtcaagcagaatgatatcgataaagaaatggcaacgagaagaagttttgtggactttgcc
gagggtctgttgaatatggatccgatcaagagatggtctcctcaacaagcattgaagcat
ccgttcattactggcgaaaaatggaccggcccatggcagcctgacacaactaccacccca
aagaaacccgtagtgccatcatctgaaccctctgcatccaactcaaacgcccctgccaac
tccatttcgacgccttccaaaaagtatggcggccttgtccaaagtcctccctcttcgcga
tctcaacgtatctattcggatgcggcggcttataaccagcaacttgcccagcatcagtcg
tatactgctcaagtgcaagcacagcagaatgctcagagagtgggccccttctcacctggt
tacaatatggctcaggcgcaggcggggggacatgcgcaagctgcaggcggtagcgggggt
ggatcaggatatggacatcatagggtcgtcagtcaacagataccgtcagctgcgtcacgt
catcatcatgcgcaacagaggcagccttcgggtcaatggaatcagcagatcgctcctcca
tcatctgccggtttccaacagcgtggtccgtcgctcaacaactctgcttctcacgcttct
ctacgtcaacctcccagcaacgtccccatcatctccaaccctcctcccaactcgtactac
ccggcctctcgtcaccgcgcaaataccatcaaccaaatggacgctatccctcctgcctta
gcgcggctggtgcatttcggcgctcaagatccgaacggttctcgaaactcgttaacaccg
gtgttgaaccgtgatgatgctattagggaatgggagaggaggcagcagggtgggcacagt
aagcagtcatcgttgcacaatgcatcttacccacagttggagtatctgcaagagcaggca
gagctcgcggcgatgcagggacagaattggatggtacccgggccatatcctccgcacccc
ggccatggacatagtcaccgatcttcttttggcgaacaatctcagagtcatggacacaga
acaaatccctcagggcaataccaaatgcagcctcacattggtatttctccaccgagcggc
aacgattatcgaccccgacctacaagcgagtacgaccctccatcatctaccgcatccgcc
agaggctacggtttacccacgtacccccctcttgcggcgacgacgagccacccccctggt
gggagtgctagcggcgcagtaggggtggggcagggagtgtttgatgcgtttgatggacgt
gacggagggatgggaatgttatataccccactacagcctaatcaagcctatgggtaccaa
gggcatgcagggcagcatgggcaggggcatggatctcgagcgagttactcagggccatat
agctcgagtaatccgtttgcaaaccaacccaacagtccaagatattaa

DBGET integrated database retrieval system