KEGG   Cryptococcus gattii: CGB_H5240WHelp
Entry
CGB_H5240W        CDS       T02232                                 

Definition
(RefSeq) serine/threonine kinase
Organism
cgi  Cryptococcus gattii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(1111514..1111871,1111931..1113088,1113147..1113346)
Genome map
AA seq 571 aa AA seqDB search
MDPPHASPTPSSSSMPATGSALTSASKLKKFKLDPMSMLLPHERPGYRGPPAAGRSMPPL
HPQLQQQSQSGPRAYFAMLQNQQVQQDPATQRFGKQMWTTASVGGQGGKRGESSGSQTTT
QALVGSHYPAQGAPLSPPASLASTPLSGSWEGSASQWSSTDGVVEGKPAPGQQSQRSRHH
AQRMSQGKVRLEDWEIVETLGTGTFGRVLLVRQRPSYRPTPYHPIFPHLYRSRHPLSPSP
STTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSERIILERVRHPFIVELYATYQDQINV
YMLLSYIPGGELFSHLRRAGRFSADVTRFYLASIVLAIEYLHSQNVIYRDLKPENLLLDR
RGYLRIADFGFAKVVQDRTFTLCGTPEYLAPEIVLSQGHGKAVDWWALGILGFEMLAGYP
PFFDDHPLGIYEKILRGDIAFPSHIDPYAKDLIRGLLTADRSKRLGNLRGGAKDVMGHPW
FAGVDWKSLERKEIGAPIVPRVASMGDSQNFQRYPPPRPQDLPGVFGQKYNTSSDQYGEL
FADFSFPEEEGQRGAGRSTEVSSGSRDSRGN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatccacctcacgcatcccctactccctcatcctcctcaatgcctgccacaggcagc
gccttgacgtccgcaagtaagctcaaaaagttcaagctcgatccgatgtcaatgcttttg
ccccacgaacgtccaggataccgtggccctcctgccgctggtcggagtatgcctccccta
catcctcaactccaacagcagtcccaatccggtccgcgagcgtattttgcaatgttgcag
aaccagcaggtacaacaggatcctgcgacacaaaggttcgggaagcagatgtggacaacg
gccagtgtgggggggcagggtgggaaacgtggagaaagcagtggcagtcagactacaacc
caagctctggttggttcgcattacccagcacaaggtgcaccattatcgcctcctgcgtca
ctggcgtcgacgcccctgtccgggtcttgggaaggttccgcctctcagtggagctcaacg
gacggtgttgtcgaaggcaagcctgcacccggacaacagtcccagcgtagtcggcatcac
gcccagcggatgagtcagggcaaggtgagattggaagactgggaaatcgtcgagacactg
ggtactgggactttcggacgagttttacttgttcgacaacgaccttcttatcgaccgacg
ccgtatcaccccatttttccccatctctatcgatctcgccatcctctctcgccgtcacct
tccacaacgcaaaaatccgatgatcatctccctcatttcgctatgaaagtcctccgcaag
tcagaaattgtgagattgaagcaagtggaacatatcaactccgagcgaattatccttgag
cgtgtacgacatccatttatcgttgaactttatgctacctaccaggaccagattaatgtc
tatatgctcttgtcttacatcccaggcggcgaacttttctctcaccttcgacgggcaggg
cggttctccgccgatgtcaccaggttctatctcgcgtctatcgtccttgccattgaatac
ctccactcgcaaaacgttatctaccgtgatctcaaacccgaaaatctccttctcgatcgt
cgtggctacctccgtatcgcggattttggctttgccaaagtggtgcaagaccgtacattc
actctatgtggtactccggaatatctcgctccggagatcgttctctctcaaggccacggc
aaagctgttgactggtgggctcttggaatcctcggtttcgagatgcttgctggctatccc
cctttctttgatgatcatcctctcggtatctatgaaaagatccttcgcggagatatcgcg
ttcccttcacatatcgatccttatgccaaagatctcattaggggacttttaacagcggat
cggagtaagaggttaggcaacctgagaggcggggcgaaggatgtaatgggacatccgtgg
tttgcgggcgtggactggaagagcttagagaggaaggaaattggagctccaatcgtccct
cgtgtagctagcatgggcgactcacagaatttccagcggtatccacccccccgaccacaa
gaccttccgggtgtattcggccaaaagtataatacatcgagcgatcaatatggcgagcta
tttgcggactttagtttccctgaggaagaaggccaaaggggagcgggtagatctactgag
gtctcgagtgggagcagagatagtagaggtaattga

DBGET integrated database retrieval system