KEGG   Cryptococcus gattii: CGB_H5240WHelp
Entry
CGB_H5240W        CDS       T02232                                 

Definition
serine/threonine kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cgi  Cryptococcus gattii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CGB_H5240W
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CGB_H5240W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CGB_H5240W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(1111514..1111871,1111931..1113088,1113147..1113346)
Genome map
AA seq 571 aa AA seqDB search
MDPPHASPTPSSSSMPATGSALTSASKLKKFKLDPMSMLLPHERPGYRGPPAAGRSMPPL
HPQLQQQSQSGPRAYFAMLQNQQVQQDPATQRFGKQMWTTASVGGQGGKRGESSGSQTTT
QALVGSHYPAQGAPLSPPASLASTPLSGSWEGSASQWSSTDGVVEGKPAPGQQSQRSRHH
AQRMSQGKVRLEDWEIVETLGTGTFGRVLLVRQRPSYRPTPYHPIFPHLYRSRHPLSPSP
STTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSERIILERVRHPFIVELYATYQDQINV
YMLLSYIPGGELFSHLRRAGRFSADVTRFYLASIVLAIEYLHSQNVIYRDLKPENLLLDR
RGYLRIADFGFAKVVQDRTFTLCGTPEYLAPEIVLSQGHGKAVDWWALGILGFEMLAGYP
PFFDDHPLGIYEKILRGDIAFPSHIDPYAKDLIRGLLTADRSKRLGNLRGGAKDVMGHPW
FAGVDWKSLERKEIGAPIVPRVASMGDSQNFQRYPPPRPQDLPGVFGQKYNTSSDQYGEL
FADFSFPEEEGQRGAGRSTEVSSGSRDSRGN
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatccacctcacgcatcccctactccctcatcctcctcaatgcctgccacaggcagc
gccttgacgtccgcaagtaagctcaaaaagttcaagctcgatccgatgtcaatgcttttg
ccccacgaacgtccaggataccgtggccctcctgccgctggtcggagtatgcctccccta
catcctcaactccaacagcagtcccaatccggtccgcgagcgtattttgcaatgttgcag
aaccagcaggtacaacaggatcctgcgacacaaaggttcgggaagcagatgtggacaacg
gccagtgtgggggggcagggtgggaaacgtggagaaagcagtggcagtcagactacaacc
caagctctggttggttcgcattacccagcacaaggtgcaccattatcgcctcctgcgtca
ctggcgtcgacgcccctgtccgggtcttgggaaggttccgcctctcagtggagctcaacg
gacggtgttgtcgaaggcaagcctgcacccggacaacagtcccagcgtagtcggcatcac
gcccagcggatgagtcagggcaaggtgagattggaagactgggaaatcgtcgagacactg
ggtactgggactttcggacgagttttacttgttcgacaacgaccttcttatcgaccgacg
ccgtatcaccccatttttccccatctctatcgatctcgccatcctctctcgccgtcacct
tccacaacgcaaaaatccgatgatcatctccctcatttcgctatgaaagtcctccgcaag
tcagaaattgtgagattgaagcaagtggaacatatcaactccgagcgaattatccttgag
cgtgtacgacatccatttatcgttgaactttatgctacctaccaggaccagattaatgtc
tatatgctcttgtcttacatcccaggcggcgaacttttctctcaccttcgacgggcaggg
cggttctccgccgatgtcaccaggttctatctcgcgtctatcgtccttgccattgaatac
ctccactcgcaaaacgttatctaccgtgatctcaaacccgaaaatctccttctcgatcgt
cgtggctacctccgtatcgcggattttggctttgccaaagtggtgcaagaccgtacattc
actctatgtggtactccggaatatctcgctccggagatcgttctctctcaaggccacggc
aaagctgttgactggtgggctcttggaatcctcggtttcgagatgcttgctggctatccc
cctttctttgatgatcatcctctcggtatctatgaaaagatccttcgcggagatatcgcg
ttcccttcacatatcgatccttatgccaaagatctcattaggggacttttaacagcggat
cggagtaagaggttaggcaacctgagaggcggggcgaaggatgtaatgggacatccgtgg
tttgcgggcgtggactggaagagcttagagaggaaggaaattggagctccaatcgtccct
cgtgtagctagcatgggcgactcacagaatttccagcggtatccacccccccgaccacaa
gaccttccgggtgtattcggccaaaagtataatacatcgagcgatcaatatggcgagcta
tttgcggactttagtttccctgaggaagaaggccaaaggggagcgggtagatctactgag
gtctcgagtgggagcagagatagtagaggtaattga

DBGET integrated database retrieval system