KEGG   Cryptococcus gattii: CGB_H5750WHelp
Entry
CGB_H5750W        CDS       T02232                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CGB_H5750W
Protein kinases [BR:cgi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CGB_H5750W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:join(1251835..1251907,1251964..1252157,1252296..1252366,1252428..1252583,1252649..1252890,1252957..1253022,1253148..1253439,1253566..1253649,1253717..1253741,1253815..1253910)
Genome map
AA seq 432 aa AA seqDB search
MSKFKISSALWDKIHHFASFPQTGVSLQQMILFGQNPSQGTLLKASQFLSEELPIRLSHR
VVELEGLPDGLNKMPSINTVKEWYAQSFDELVSFPKPRLKPELEEILRIPPAPTQPFPSA
TPNPSLDPLMREGPVGSGFVSERHIGTGGNGIGVGKRLRIPIERRYFSPPPPTIIYPPEV
HDYNEKFTGLLQIIKHRHDPTVTTVAQGVLEWKRMQRASVIGTPIQEFLDRFYMSRIGIR
FLIGQHIALNTLPPHPDYVGIICTRAVHNARYVCEEHYALFKSPNIQLVCPPDLTFPYIP
GHLSHICFELLKNSLRAVVERYGVDNDDEYPPIKMVVVEGREDITIKISDEGGGIPRSAI
PHIWTYLYTTMSDEGLEDTIQGSDFKAPMAGFGYGLPLSRLYARFFGGDLRLISMDGYGT
DVYISLNKLSSR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcaagatctcttccgcactatgggacaaaatccaccattttgcatctttt
cctcaaaccggagtttctcttcaacagatgatcctcttcggccagaatccatctcaagga
acactcctcaaagcttcacaattcctttcggaagagttaccaataagactatctcataga
gtggtagagctcgaaggccttccagatgggctaaataagatgcccagtataaataccgta
aaggaatggtacgcgcaaagttttgatgaactggtatcttttccaaaaccaagactcaag
cccgagctggaagagattttacgcatcccgcccgcacctacacaaccattcccctctgct
actccaaacccctcgctcgacccgcttatgcgtgaaggaccagtaggatctggatttgtg
tcggaaagacatataggcacaggaggcaatggcataggagttgggaagagactgagaata
cctatcgaacggagatacttctccccgcctccaccgaccataatctatccccctgaagtt
cacgactacaacgagaaattcaccgggcttcttcaaatcatcaagcaccgacatgatccc
actgtgactacggttgcgcaaggcgttttagaatggaagagaatgcagagggcgagcgtg
attgggactccaatacaggagtttttggatagattttacatgagtagaattgggatcagg
ttcttaatcggacagcatattgcgctaaacactctcccacctcatcctgattatgttggt
ataatctgcacaagagcagtacataacgcccgctacgtctgtgaagaacattatgccctc
ttcaaatcccctaatatccagctcgtctgcccgcccgacctcacattcccttatatccca
ggtcatctttctcacatctgttttgaactcctcaaaaactctctgcgtgctgtggtagag
cgatacggcgtcgacaatgatgatgagtatcctccgatcaagatggtcgtggtggaagga
agggaggatatcacgatcaagatctctgatgagggtggtgggattccgagaagcgccata
ccacacatttggacttacttatacacaacgatgagcgatgaaggtctagaagataccatt
caaggctcggactttaaggctcccatggcaggatttggctatggccttcctctttctcgt
ctctacgctcgattctttggtggtgatctgagattgatctccatggacgggtacggcacc
gacgtttacatctctctcaataaactttcatctaggtaa

DBGET integrated database retrieval system