KEGG   Cryptococcus gattii: CGB_I0310CHelp
Entry
CGB_I0310C        CDS       T02232                                 

Definition
dolichyl-phosphate-mannose--protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cgi  Cryptococcus gattii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CGB_I0310C
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CGB_I0310C
Glycosyltransferases [BR:cgi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CGB_I0310C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(join(90635..91127,91193..91514,91585..91732,91786..91943,91992..92495,92543..92638,92686..93296,93348..93500,93547..93821))
Genome map
AA seq 919 aa AA seqDB search
MSQPLTRRAPLQPHPSQPSTFASKVTVESEADARLKDHHAGPYTIQKTAFGGKRGSAAVG
RIGKREWTMIAGMVVVALYVRLYRLGRPSSVVFDEVHFGGFAMKYIRRKFFMDVHPPLAK
LLVTLSAWVGGFDGKFDFKDIGKDYLEPGVPYITMRFFPAALGIALIPLAFLTLLALRLS
HTSALLGALFVTFDNALITQSRLILLDSFLVFFTGLTTFFWVRFSNEDSEGRAFTKPWWI
NLLCTGLSLGAVVSCKWVGLFTIAMIGVGTLRQLWLLLGNLKVTPRQYIRHFAARTLCLI
VVPLAFYMLMFKIHFWILNESGDGDGFMSSEFQHTLQGHGMADTFADVGFGSKVSIRHVN
TQGGYLHSHPHPYPGGSKQQQITLYPHRDDNNVWRIVNASAPDGPSSYPWDELPFEYVLT
GTKIRLEHVTTEKRLHSHDIRPPVSEVDFQNEVSGYGFPGFAGDANDDFIVEITKHTRGR
NDKQAKHRLKTLRSEFRLRHALSGCYLFSHKVKLPDWGYEQQEVTCNKNPTWENSLWYIE
TNQHAQLSMDAERVNYEKPSFFEKFFELNAVMWRTNAGLTERHAYDSRPQHWPWLRRGIN
FWVKDHRQVYLIGNPVVWWSSTAAIVAYVIVRGFLVLRAQRGYRDLNQPKLAFYDDICAF
CVIGWALHYFPFYLMQRQLFLHHYLPALYFAILLFCTVFDYTTSALRPRIRTNIAIAILI
LALWSWNHWSSLAYAGEWTKSACENGKWLRTWDFSCNDFYESTSMYNSHAAMSSEKIAAT
DLGPDSATTTFIEDVPEPIQNVFQQDPPPEEKTIAPVGPAPVVQMEESSAVFIPEGEEAP
VVEDLRAPVGNDAGDPAVTDGEDDGGWHGGAEEGQHGQRKDEVKTKEGEAPVGARVDIPD
MGLDEERKLLVDQIMSEQE
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaccactcacccgccgcgctcctcttcagccccacccttcccaaccgtcaacc
tttgcgtcaaaagttaccgtcgaatctgaagctgatgcgcgtttgaaagaccatcatgct
ggaccatacacaatccagaaaactgcgtttggcgggaagagaggctctgcagcagtaggg
cggattggaaagagggagtggacgatgatcgcggggatggtcgtagttgcgctttatgtg
agactgtacaggcttggcaggccgagcagcgtcgtttttgatgaagtgcatttcggaggc
tttgccatgaagtatatccggcgcaagttctttatggatgtgcaccctccactagcaaaa
ctcttggtcactctcagcgcttgggtcggtgggttcgacgggaagtttgatttcaaggat
attggaaaggattatcttgaacctggcgttccctacattacaatgcgattcttccctgct
gccctcggtattgctctcatccctctcgcctttcttactcttctcgctcttcgcctctca
cacacttctgcactcctgggcgccctttttgtcacatttgataacgccctcatcactcaa
tcccgactcatcctcttagactctttcctcgtcttcttcaccggccttactacttttttc
tgggttcgcttctccaatgaagattctgaaggcagagcgttcacgaagccgtggtggata
aatttactttgtaccggccttagtcttggtgctgttgtctcatgtaaatgggtcggcctg
ttcactattgccatgatcggcgtcggaacccttcgtcaactctggcttctcctcggtaat
ctcaaggttacccccaggcagtacatcagacactttgcggctcggacgctgtgcttgatt
gtggtacccttggctttctatatgctgatgtttaaaatccacttctggattttgaacgaa
agcggagatggagatgggttcatgagctcggagttccagcatacattgcagggtcatggc
atggctgacactttcgctgatgttggttttggttcaaaggtgtccatccgacatgttaac
actcagggtggttaccttcattcacacccccatccttaccctggcggctctaagcagcaa
caaatcaccctctacccccatcgagacgacaacaacgtctggcgaatcgttaatgcttcg
gcccccgacggaccatcctcttatccctgggatgaacttccctttgaatatgttcttacc
ggcactaagatccgtctcgagcatgtcacgaccgagaagcgtcttcattctcacgacatc
cgaccgcctgtcagtgaagtggactttcaaaacgaagtttctggctatggttttcccggc
tttgctggtgacgccaatgacgatttcatcgtggaaattacgaagcatacaagagggagg
aatgacaagcaggccaagcacagactcaagaccctccgaagcgagttcaggctaaggcac
gctttgtctggatgctacttgttctcacacaaagtcaagttgcctgactggggttacgag
caacaagaggtgacctgtaacaagaaccctacttgggagaactctttgtggtacattgaa
accaaccagcatgctcaattgtctatggacgcagagcgagtcaattatgaaaaacctagc
ttctttgaaaagttcttcgagctcaacgctgtgatgtggagaaccaacgctggattgact
gagaggcatgcttatgattctcgaccacaacactggccttggctcaggcgtggcattaat
ttctgggtcaaggatcacaggcaggtctacctcatcggtaaccccgtggtttggtggtct
agcactgccgctatcgttgcctatgtcattgtgagagggttcttggttttgcgcgctcag
aggggttacagggacttgaaccaacccaagctcgcattctacgatgatatttgcgctttc
tgcgtcattggttgggcactccattatttcccgttctatctcatgcaacgccagctcttc
ttgcaccattatctccccgcactctactttgccattcttcttttctgtaccgtctttgat
tacaccacatctgcgctcaggccaaggattaggacgaacattgctatcgcgattttgatt
cttgcactttggagttggaatcattggagtagtttggcgtatgctggagagtggactaag
agcgcctgtgagaatggaaagtggttgaggacttgggatttctcttgtaacgacttttac
gagagcactagcatgtacaactcccacgctgccatgtcaagcgaaaaaattgctgctacc
gatctcggtcctgactcggccacgaccacattcatcgaagatgtccctgagcctatccaa
aatgttttccagcaagatccccctcctgaggaaaaaaccattgcgcccgttggtcccgcg
cccgtagttcagatggaagagtcttcagcggttttcattcctgaaggggaggaggcgcca
gtcgttgaggatttgagagcgccagtggggaacgatgcgggtgatccggcagtgacggat
ggtgaggatgatggtggctggcacggaggtgcagaggagggacagcatggacaaagaaag
gatgaagtgaagacaaaggaaggtgaggcgcctgtaggtgccagggttgacattcctgat
atgggattggatgaggaacggaagttgttggtggatcagatcatgagtgaacaggagtaa

DBGET integrated database retrieval system