KEGG   Cryptococcus gattii: CGB_I1130WHelp
Entry
CGB_I1130W        CDS       T02232                                 

Definition
eukaryotic translation initiation factor PRT1p
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cgi  Cryptococcus gattii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CGB_I1130W
Translation factors [BR:cgi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CGB_I1130W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:join(242485..242576,242647..242832,242888..243074,243128..243274,243340..244020,244073..244226,244283..244701,244752..245147)
Genome map
AA seq 753 aa AA seqDB search
MSVTDLDYFSKDEQREIEVELDTGFKVIEEKYAVAAQKGFETMLVVDNIPAVDDSKKQRL
LERLRQTFAKVGAPIEVESIDMPWNAATGTNKGFIFLTYPDVKEAENAIHALDGVSFGKN
VLHVNRFGDIQRFASMPIGESDLPSGWKEKEYIEKDYLRNWLGDLAGRDQYVTFWDAEVT
VWWNGRNGTAEALKGSDGKPLKNNKWGELYLQWSTMGTYLASLHRVGVALWSGPKLDGPI
GVNVLRFTHPNVRLIQFSPCENYLVTWSEDPLPNYENHPNAALRDTFGPEDEGNQYVVWD
IKTTRVLRTFPGDKSAFGADDSQSRLSWPAFKWSADDSYIAKCNVGAGISVYELPTMGLL
DKKSIKIEGVQDFEWCPMSQKDLIARQEGKGKECVLAFWTPEAQNQPARVNIMAVPSRTI
LRSKNLFNVSECKFYWQSQGDFLCVKVDRHARKAKSKKATSCNLEIFRMREKDYPVEVLE
FKDYVPQFAWEPSGTRFAIVLQTETNISSVSGVSTKYSIDFYQLDSKKGDFIAIKHLDSK
MANTLVWSPKGRHIALATIGSSSKYDIEFWDLDFTIDERREAAELGANVTMLGTGEHYGI
TEIAWDPSGRYIATSASTWRQSPEPGFSIWDFKGQQLLHESRDRFKQFLWRPRPPTLLSK
EQIKKVRKELREYSRQFDEEDAAEENRGSAEKLAQRRREIGEWNAWRARNNDRLVVEREK
RGKSKAKIDVQGQEARVEEWVEELIDETEELSR
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccgacttagactacttttcaaaagatgagcagcgtgagattgaagttgag
ctcgacactggcttcaaggtcattgaggaaaagtatgctgtggccgcccagaagggcttt
gagacgatgttggtcgttgacaacatccctgccgtcgacgatagtaagaagcagagactg
ttggagcgattgaggcagacgttcgccaaagtgggcgcgcccattgaggttgaaagtatc
gacatgccttggaacgcagcaaccggcactaataaaggtttcattttcctgacatacccc
gatgtgaaggaagcggaaaatgccatccacgccctcgacggtgtgtcctttggtaaaaac
gtgctgcatgtcaatcgatttggagacatacaacgtttcgccagtatgcctatcggtgag
agcgatctgccatcgggctggaaagagaaggagtatatcgagaaggattacttgcgaaac
tggcttggggatcttgctgggagagaccagtatgtaaccttctgggatgcagaggttact
gtgtggtggaacggacgcaatggaaccgccgaggctctaaaggggtcagacggtaaacct
ctgaagaacaataaatggggtgagttgtatctacaatggtctaccatgggaacctacttg
gcttcacttcatcgtgtgggcgttgctctttggtccggtcccaaactcgatggacccatt
ggcgtcaatgtgctcagattcactcaccccaatgtccggcttatccagttttccccctgc
gagaattacctcgttacctggtcagaagatcctcttccgaattatgagaatcatcccaat
gcagcgctacgcgacacttttggtcctgaagacgaaggaaatcagtatgtcgtttgggac
atcaagacgacgcgtgttcttcggacattcccaggtgataaatccgcatttggtgcagat
gacagtcaatcccgcttatcgtggccagccttcaagtggtctgcggatgactcgtatatc
gcgaagtgcaatgtcggcgcggggatttcagtgtatgagttgcctactatgggattgtta
gataaaaagagtataaaaattgagggggtacaagactttgagtggtgtcctatgagccag
aaggatttgatagcgaggcaagaaggaaaggggaaagagtgtgttctggccttctggacc
cctgaagctcagaatcagccggctagagtgaacataatggctgttccaagccggacgatc
ttgagatcaaagaatctgtttaatgtctctgaatgtaaattttactggcagagtcaaggt
gactttctttgtgtaaaggttgaccgccatgctcgaaaggccaaatccaaaaaggctact
tcgtgcaacttggaaattttccgcatgcgtgagaaagattaccctgtggaggtccttgaa
ttcaaagactacgttccacaatttgcgtgggagccttcgggcactcgttttgccatcgtc
ctccaaacggaaacaaacatttcatcggtctctggggtgtcgaccaaatacagtatcgac
ttctatcagcttgattccaagaagggtgatttcattgcaattaagcatcttgacagcaag
atggccaatactcttgtttggtcgcccaagggtcgccatatcgcattggccaccatagga
tcgtccagcaagtatgatatcgaattctgggatcttgatttcaccatcgacgaaaggcga
gaggctgctgagcttggagccaacgtcactatgttgggcactggggagcattacggtatc
acagagattgcttgggatcctagtggacgatacattgcgacttctgcatctacatggcga
cagtctcctgagcctggcttttctatttgggatttcaagggccaacagctcctacacgaa
tcgcgggatcgcttcaagcagttcctttggcggcctcgtcctccaacgctgcttagtaag
gaacagattaagaaggtcagaaaggaacttcgagaatattcgcgccagttcgacgaagaa
gatgctgcggaggagaaccgagggagtgccgaaaagctcgcccaacgtcgcagagagatt
ggggagtggaatgcttggagggctaggaacaatgacaggctggttgttgagcgcgagaaa
aggggcaagtcaaaagccaagattgatgttcaaggccaggaggcgcgggttgaagagtgg
gttgaagagcttatcgatgagactgaggaattgtcgaggtaa

DBGET integrated database retrieval system