KEGG   Cryptococcus gattii: CGB_I2570WHelp
Entry
CGB_I2570W        CDS       T02232                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cgi  Cryptococcus gattii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cgi00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:join(546406..546735,546781..547183,547230..547498,547551..548319,548402..548782,548849..548892,548949..549176)
Genome map
AA seq 807 aa AA seqDB search
MHRGIPSPPAIRRHTATQHTPWENRVPPSSYGSARPHSALLESTPHDDAELPLYKDTNME
LKRRFEEKQPVHLEQPVVDDDQGKWGKGYGAGPGIGGRRGLPPRQRIPGWKGIVLEHEEW
VWAGVYTLLSMITRFWRIGAANYVVWDEAHFGKFGTHYINRDFYFDVHPPLGKMLVGLAG
LLSGYQGNFEFKSGVAYPEDVPYTAMRVMLASFGVALVPLAWFTSGEMGWSRWTRHWVTI
CVLCDIGWLCISRFILLDSMLLFFTFTTTLGLVKFRNQRHAPFSDDWWIWLVFTGWSIGC
VCSVKWVGMFITALVGLYTIEDLWEKFGDLSMPIRTYITHWIARIACLIILPFIVYASCF
KMHFLILNRSGPGDAQMSSLFQAHLRGNDFAESPLEIAYGSTVTLKNYGYGGGLLHSHVQ
TLPVGSLQQQITCYHYKDENNNWQIVPPWGADPVDPDGPIRFLKDGDEIRLVHTQTGRNM
HSHAIAAPVTKESWEVSGYGNLTIGDANDLWVIEVVDDTHTSKKDNENGRIHSLTTRMRL
KHRELNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHTYWNVESHWNGRLPPGNAKLYK
SPFWRDFVHLNVAMWTSNNALIPDPDKEDILASEPFDWPFLHLGLRMCGWGDHQIKFYLL
GTPIIWWFSTVSLAIGLGLAAWYVARMQRGYKEWKAGEWDHWLWAGKVAFGGWALHFFPF
LIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASPTRSHTKKLIWFTVWAGVVILSFWWF
KDLALGIYGNVNNHWGWGWRSSWNIYN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggggcataccatcccctccagcaatacgcagacacacagccacacaacacacg
ccctgggagaacagagtgcctccctcatcctacggttcggcacgcccacacagcgctctt
ctcgaatcaacaccacacgacgacgcagagctcccgctctacaaggacaccaacatggag
ctcaagagacgcttcgaagagaagcaaccggtacatttagagcagcccgtcgtggacgac
gatcagggcaagtggggaaagggttacggtgcgggaccaggtatcggcggcagaagaggt
ctgccgccaagacagagaataccgggatggaaaggtatcgtgctggaacacgaagaatgg
gtatgggcaggggtctacaccctgctgagtatgattacacgattttggcgcatcggtgct
gccaattacgtcgtctgggacgaggcgcattttggaaagtttgggacacactatatcaat
cgtgatttctactttgatgtccaccctccactcggcaagatgctcgtcggtcttgcaggt
ttgctgtcaggctaccagggcaactttgaattcaagtcgggtgttgcgtacccggaagat
gtaccgtatacggcgatgagagtaatgctggcgagctttggtgtggctctcgtaccactt
gcctggtttacttctggagagatgggatggagtaggtggaccagacattgggtgaccatt
tgtgtattgtgtgacattggatggctttgtatttcccgatttattctcctcgactccatg
cttttgtttttcacctttactaccacccttggcctagtcaaattccgtaatcaacgacac
gccccatttagcgatgattggtggatctggcttgtctttacgggatggtcgataggctgt
gtgtgtagtgtcaagtgggtgggaatgtttatcaccgcgcttgtcggcctttacactatt
gaggatttgtgggaaaagtttggtgacctctccatgcccattcgcacgtacatcacccac
tggattgcccgaatcgcttgtctcataatccttcccttcatcgtctacgcctcgtgcttc
aagatgcatttcctcatccttaaccgatccggccccggtgacgcccagatgtcttccctc
ttccaagcccatttgcgtggtaacgactttgccgagtctcctctggaaatcgcctacggc
agtaccgtcaccttgaaaaactacggctatggcggtggtttgctgcactcgcacgtacag
accttgcccgtgggaagtcttcagcaacagattacgtgttatcactacaaggacgagaat
aacaactggcagatcgtacctccctggggcgccgatcctgttgacccagacggacccatt
agattcttgaaggacggtgatgaaatccgacttgtgcatacccaaactggacgaaatatg
cattcacacgctatcgctgcgccagtcaccaaggagagctgggaagtttctgggtatggt
aatcttaccattggcgacgccaacgatctttgggttatcgaggtcgtcgatgatacccac
acatccaagaaggataacgaaaatggtcgtatccactcgttgaccacgcggatgagactc
aagcaccgcgaattaaattgttaccttcgtgccgccaatgccgtcctgcctcaatggggt
ttcaaacaggtagaagtctcgtgtacaaaggagaacaacccaaaggatttacacacgtac
tggaacgtcgagtctcactggaacgggcgattgccccctggtaacgccaaactgtacaaa
tcgcccttctggcgggactttgtccacctcaacgtcgccatgtggacatccaacaatgct
ctcattcccgaccctgataaggaagacattctcgcttccgagccattcgactggccattc
ctccacctcggtcttcgcatgtgcggctggggcgatcaccaaatcaagttttacctcctt
ggtacacctatcatctggtggttctcaaccgtcagcttggcgattggtttgggcttggct
gcttggtatgtggcgaggatgcagaggggatacaaggagtggaaagcgggagaatgggat
cattggctttgggcaggtaaggtggcgtttggtggctgggctttgcatttcttccccttt
ttgattatgggtcgagttacatatcttcaccattatcttcccacattatactttgctgtt
ctcatggccggccatatccttgaccacttcttcttcgcctctcccactcgctcacacact
aaaaagctcatttggtttaccgtctgggcaggagtggtgatactgagtttctggtggttc
aaggacctcgctctaggtatctatggtaacgtgaacaaccactggggttggggatggagg
tcctcttggaatatctacaactga

DBGET integrated database retrieval system